Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G2E770

Protein Details
Accession A0A0G2E770    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-31QDPYRCLSARRRRRSGLQPYRGTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 7, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
Pfam View protein in Pfam  
PF12273  RCR  
Amino Acid Sequences MRLFLGGLQDPYRCLSARRRRRSGLQPYRGTGWVGRTPFGHGPAQYNPNYNQQAQYNPPPPQYTPQGGYYGGAGQNQGYFGGGQQNGVELQQPSNVYRGGEPVYEPPAGPPPSKKDNPAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.28
3 0.37
4 0.47
5 0.57
6 0.63
7 0.66
8 0.74
9 0.81
10 0.82
11 0.82
12 0.81
13 0.75
14 0.7
15 0.68
16 0.61
17 0.51
18 0.42
19 0.36
20 0.31
21 0.27
22 0.25
23 0.22
24 0.25
25 0.25
26 0.27
27 0.24
28 0.19
29 0.22
30 0.25
31 0.29
32 0.26
33 0.27
34 0.26
35 0.32
36 0.34
37 0.31
38 0.29
39 0.25
40 0.27
41 0.28
42 0.32
43 0.3
44 0.29
45 0.3
46 0.3
47 0.29
48 0.29
49 0.3
50 0.26
51 0.23
52 0.23
53 0.23
54 0.21
55 0.2
56 0.17
57 0.15
58 0.13
59 0.11
60 0.09
61 0.08
62 0.08
63 0.08
64 0.07
65 0.06
66 0.05
67 0.05
68 0.1
69 0.1
70 0.1
71 0.1
72 0.11
73 0.11
74 0.11
75 0.13
76 0.08
77 0.09
78 0.11
79 0.13
80 0.13
81 0.15
82 0.16
83 0.15
84 0.14
85 0.17
86 0.16
87 0.15
88 0.16
89 0.17
90 0.2
91 0.19
92 0.19
93 0.18
94 0.25
95 0.27
96 0.28
97 0.3
98 0.34
99 0.43
100 0.47