Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q9C0X4

Protein Details
Accession Q9C0X4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-25ELQYNFKKRRKTHNGISRFQRSAHydrophilic
NLS Segment(s)
PositionSequence
66-73EKKVKGKG
Subcellular Location(s) nucl 13, mito 7, cyto_nucl 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG spo:SPBC12C2.14c  -  
Amino Acid Sequences MEELQYNFKKRRKTHNGISRFQRSALPLTIVYTIWSTFGSPCSGDQRVTLSITSILRKVQDRRESEKKVKGKGREEYRRYYFFLLFYVSFPHIFLGLFFFIDKKILPFQSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.83
4 0.82
5 0.84
6 0.81
7 0.71
8 0.63
9 0.56
10 0.48
11 0.43
12 0.37
13 0.3
14 0.22
15 0.22
16 0.22
17 0.18
18 0.17
19 0.13
20 0.11
21 0.09
22 0.09
23 0.08
24 0.08
25 0.09
26 0.09
27 0.09
28 0.1
29 0.14
30 0.15
31 0.15
32 0.15
33 0.17
34 0.17
35 0.17
36 0.16
37 0.11
38 0.13
39 0.13
40 0.14
41 0.12
42 0.11
43 0.12
44 0.15
45 0.19
46 0.25
47 0.31
48 0.36
49 0.43
50 0.52
51 0.57
52 0.61
53 0.66
54 0.63
55 0.64
56 0.66
57 0.66
58 0.64
59 0.65
60 0.69
61 0.71
62 0.7
63 0.7
64 0.7
65 0.66
66 0.61
67 0.56
68 0.46
69 0.36
70 0.32
71 0.27
72 0.22
73 0.19
74 0.19
75 0.17
76 0.16
77 0.15
78 0.15
79 0.12
80 0.11
81 0.11
82 0.11
83 0.1
84 0.1
85 0.1
86 0.1
87 0.1
88 0.12
89 0.12
90 0.12
91 0.18