Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O94723

Protein Details
Accession O94723    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
17-44QTRNLNRLYPKQRIPKRPKIPMGSKIAEHydrophilic
167-192EKLAWGSKKREIRRQRASRQAFRTLEHydrophilic
NLS Segment(s)
PositionSequence
174-180KKREIRR
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG spo:SPCC1393.11  -  
Pfam View protein in Pfam  
PF12824  MRP-L20  
Amino Acid Sequences MLFTIKPSFLKPVGFIQTRNLNRLYPKQRIPKRPKIPMGSKIAEVTETTSAYYNPPASSPDVRITPPVFRYDAPPIHQRDTSLSKESMFLPPAVSRKSKSKGKLRFSTHQLSSEDIKSIQDLRTKDPNAWTTGTLSKKFNTTRLLISRVCEAPKERIQKVEENFEAEKLAWGSKKREIRRQRASRQAFRTLERVAQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.37
4 0.45
5 0.46
6 0.48
7 0.42
8 0.37
9 0.41
10 0.5
11 0.51
12 0.5
13 0.55
14 0.62
15 0.7
16 0.78
17 0.82
18 0.83
19 0.85
20 0.87
21 0.87
22 0.86
23 0.85
24 0.82
25 0.8
26 0.71
27 0.63
28 0.54
29 0.45
30 0.37
31 0.28
32 0.23
33 0.16
34 0.14
35 0.13
36 0.12
37 0.12
38 0.12
39 0.15
40 0.14
41 0.12
42 0.12
43 0.14
44 0.17
45 0.19
46 0.21
47 0.21
48 0.22
49 0.22
50 0.25
51 0.25
52 0.24
53 0.24
54 0.24
55 0.22
56 0.2
57 0.24
58 0.27
59 0.28
60 0.28
61 0.33
62 0.34
63 0.35
64 0.35
65 0.32
66 0.3
67 0.32
68 0.32
69 0.29
70 0.26
71 0.23
72 0.24
73 0.25
74 0.22
75 0.18
76 0.15
77 0.12
78 0.14
79 0.16
80 0.18
81 0.18
82 0.17
83 0.23
84 0.29
85 0.34
86 0.39
87 0.46
88 0.53
89 0.6
90 0.67
91 0.67
92 0.67
93 0.67
94 0.66
95 0.58
96 0.54
97 0.46
98 0.4
99 0.36
100 0.3
101 0.25
102 0.18
103 0.17
104 0.13
105 0.14
106 0.14
107 0.16
108 0.17
109 0.21
110 0.29
111 0.3
112 0.31
113 0.34
114 0.34
115 0.32
116 0.32
117 0.28
118 0.23
119 0.28
120 0.31
121 0.29
122 0.28
123 0.26
124 0.31
125 0.32
126 0.34
127 0.32
128 0.3
129 0.34
130 0.36
131 0.41
132 0.35
133 0.35
134 0.35
135 0.34
136 0.32
137 0.28
138 0.27
139 0.29
140 0.35
141 0.41
142 0.38
143 0.42
144 0.44
145 0.49
146 0.5
147 0.51
148 0.45
149 0.43
150 0.42
151 0.36
152 0.33
153 0.26
154 0.25
155 0.17
156 0.19
157 0.18
158 0.22
159 0.26
160 0.33
161 0.42
162 0.47
163 0.57
164 0.64
165 0.71
166 0.78
167 0.84
168 0.86
169 0.88
170 0.9
171 0.89
172 0.85
173 0.85
174 0.78
175 0.71
176 0.66
177 0.59