Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O94690

Protein Details
Accession O94690   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
70-92FVRRKGRLYVLCKKHPRHKTRQGBasic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
GO:0042254  P:ribosome biogenesis  
KEGG spo:SPBC83.06c  -  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASLGRKFFAVGVLSRVFPSAFNAQKGLLKNASMFLTPAFRLSPSLLPWNFSRGFKVKASVKKRCSSCYFVRRKGRLYVLCKKHPRHKTRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.16
5 0.14
6 0.17
7 0.2
8 0.21
9 0.22
10 0.23
11 0.23
12 0.27
13 0.29
14 0.28
15 0.22
16 0.19
17 0.18
18 0.19
19 0.19
20 0.15
21 0.14
22 0.1
23 0.11
24 0.11
25 0.11
26 0.09
27 0.09
28 0.1
29 0.11
30 0.12
31 0.12
32 0.18
33 0.17
34 0.19
35 0.19
36 0.22
37 0.23
38 0.21
39 0.24
40 0.2
41 0.24
42 0.23
43 0.28
44 0.31
45 0.38
46 0.47
47 0.52
48 0.55
49 0.6
50 0.62
51 0.63
52 0.62
53 0.6
54 0.61
55 0.62
56 0.66
57 0.68
58 0.75
59 0.73
60 0.72
61 0.72
62 0.71
63 0.7
64 0.68
65 0.69
66 0.68
67 0.73
68 0.78
69 0.8
70 0.8
71 0.82
72 0.84