Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G2EP59

Protein Details
Accession A0A0G2EP59    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-29APAAATKKAGRKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23KKAGRKKWSKGKVKDK
Subcellular Location(s) cyto 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAATKKAGRKKWSKGKVKDKAQHAVVLDKALSDKLNKDVQAYKLVTVAVLVDRLKINGSLARKALNDLEERGVIKKVVGHARGSIYTRAAAGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.81
3 0.83
4 0.85
5 0.89
6 0.9
7 0.91
8 0.87
9 0.83
10 0.8
11 0.72
12 0.65
13 0.55
14 0.48
15 0.38
16 0.31
17 0.24
18 0.17
19 0.15
20 0.12
21 0.11
22 0.09
23 0.1
24 0.13
25 0.17
26 0.17
27 0.19
28 0.21
29 0.23
30 0.28
31 0.27
32 0.23
33 0.2
34 0.2
35 0.17
36 0.13
37 0.12
38 0.05
39 0.07
40 0.06
41 0.06
42 0.07
43 0.07
44 0.08
45 0.08
46 0.08
47 0.1
48 0.13
49 0.14
50 0.15
51 0.17
52 0.17
53 0.19
54 0.2
55 0.19
56 0.19
57 0.18
58 0.2
59 0.19
60 0.19
61 0.19
62 0.19
63 0.16
64 0.14
65 0.15
66 0.19
67 0.25
68 0.26
69 0.27
70 0.28
71 0.32
72 0.35
73 0.35
74 0.31
75 0.25
76 0.24
77 0.23