Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O13684

Protein Details
Accession O13684   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-39QAKGKSSKLIHKLPKQRTRISQGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13.333, cyto 5.5, cyto_pero 3.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR040349  Csm1/Pcs1  
IPR020981  Csm1/Pcs1_C  
IPR038608  Csm1/Pcs1_C_sf  
Gene Ontology GO:0034506  C:chromosome, centromeric core domain  
GO:0000775  C:chromosome, centromeric region  
GO:0005829  C:cytosol  
GO:0000776  C:kinetochore  
GO:0072686  C:mitotic spindle  
GO:0033551  C:monopolin complex  
GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:1990644  F:microtubule site clamp  
GO:0051315  P:attachment of mitotic spindle microtubules to kinetochore  
GO:0051301  P:cell division  
GO:0045144  P:meiotic sister chromatid segregation  
GO:1990893  P:mitotic chromosome centromere condensation  
GO:0000070  P:mitotic sister chromatid segregation  
KEGG spo:SPAC11E3.03  -  
Pfam View protein in Pfam  
PF12539  Csm1  
Amino Acid Sequences MRKNNMQTSKDSELKEQAKGKSSKLIHKLPKQRTRISQGQMHSTQDFVNNEDQDAYSVRENENELHINNSGMSELNKKLQLPNVELSTLSHTQEQEFNELNKLIRKINELQEFYLLEDLAKPVTNAGADADDTIVKDLKKELENEKKANHSLKNELLKTREQIKNYSKINILIKELFGLEVADCIEDEDGYRFNCKNTGRRGTLEYQLLLDDQNFTFTPRLNVQTDEELMKHLPDYLLEEIIFTKEQGKLFSARLMKALQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.53
4 0.49
5 0.52
6 0.53
7 0.51
8 0.5
9 0.52
10 0.54
11 0.56
12 0.61
13 0.62
14 0.69
15 0.77
16 0.79
17 0.83
18 0.81
19 0.81
20 0.8
21 0.79
22 0.78
23 0.74
24 0.69
25 0.63
26 0.64
27 0.58
28 0.54
29 0.46
30 0.38
31 0.33
32 0.31
33 0.28
34 0.23
35 0.26
36 0.22
37 0.22
38 0.22
39 0.21
40 0.17
41 0.17
42 0.17
43 0.14
44 0.15
45 0.15
46 0.16
47 0.17
48 0.17
49 0.2
50 0.2
51 0.18
52 0.19
53 0.19
54 0.17
55 0.16
56 0.14
57 0.11
58 0.09
59 0.1
60 0.11
61 0.13
62 0.16
63 0.17
64 0.18
65 0.2
66 0.24
67 0.26
68 0.26
69 0.28
70 0.26
71 0.25
72 0.24
73 0.23
74 0.23
75 0.21
76 0.18
77 0.17
78 0.16
79 0.17
80 0.2
81 0.2
82 0.19
83 0.19
84 0.19
85 0.18
86 0.19
87 0.19
88 0.19
89 0.19
90 0.17
91 0.17
92 0.2
93 0.23
94 0.3
95 0.36
96 0.33
97 0.32
98 0.32
99 0.31
100 0.27
101 0.23
102 0.15
103 0.08
104 0.07
105 0.07
106 0.06
107 0.05
108 0.05
109 0.04
110 0.05
111 0.05
112 0.04
113 0.05
114 0.04
115 0.04
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.07
122 0.06
123 0.06
124 0.08
125 0.1
126 0.12
127 0.15
128 0.23
129 0.32
130 0.37
131 0.39
132 0.41
133 0.41
134 0.43
135 0.45
136 0.4
137 0.33
138 0.33
139 0.36
140 0.41
141 0.4
142 0.39
143 0.36
144 0.35
145 0.35
146 0.39
147 0.37
148 0.31
149 0.37
150 0.4
151 0.45
152 0.45
153 0.45
154 0.38
155 0.39
156 0.41
157 0.36
158 0.33
159 0.26
160 0.24
161 0.22
162 0.2
163 0.15
164 0.11
165 0.1
166 0.06
167 0.06
168 0.06
169 0.05
170 0.05
171 0.05
172 0.05
173 0.04
174 0.05
175 0.06
176 0.08
177 0.08
178 0.12
179 0.12
180 0.12
181 0.18
182 0.22
183 0.28
184 0.36
185 0.44
186 0.44
187 0.47
188 0.52
189 0.5
190 0.52
191 0.47
192 0.38
193 0.3
194 0.27
195 0.24
196 0.2
197 0.16
198 0.13
199 0.1
200 0.12
201 0.11
202 0.13
203 0.14
204 0.15
205 0.19
206 0.2
207 0.25
208 0.24
209 0.27
210 0.28
211 0.3
212 0.31
213 0.29
214 0.25
215 0.23
216 0.21
217 0.19
218 0.16
219 0.14
220 0.12
221 0.11
222 0.15
223 0.15
224 0.16
225 0.15
226 0.16
227 0.15
228 0.17
229 0.17
230 0.13
231 0.14
232 0.16
233 0.18
234 0.19
235 0.21
236 0.22
237 0.24
238 0.31
239 0.32
240 0.3
241 0.32