Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G2GF14

Protein Details
Accession A0A0G2GF14    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
77-96YLKYLTKKYLKKNQLRDWLRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 9, mito 5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPTTKGKAAKVTSKYTIDASQPVNDKIFDISAFEKFLHDKIKVEGRVGNLGDTITISQAGEGKVEVVAHIPFSGRYLKYLTKKYLKKNQLRDWLRVVSVSKGVYQLRFYNVADDDAEEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.46
4 0.43
5 0.36
6 0.35
7 0.31
8 0.3
9 0.31
10 0.31
11 0.29
12 0.26
13 0.24
14 0.2
15 0.19
16 0.14
17 0.13
18 0.13
19 0.13
20 0.14
21 0.13
22 0.13
23 0.13
24 0.16
25 0.17
26 0.16
27 0.16
28 0.18
29 0.26
30 0.26
31 0.26
32 0.26
33 0.24
34 0.27
35 0.26
36 0.23
37 0.15
38 0.14
39 0.13
40 0.1
41 0.09
42 0.04
43 0.04
44 0.04
45 0.04
46 0.06
47 0.06
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.07
61 0.11
62 0.1
63 0.11
64 0.15
65 0.21
66 0.27
67 0.33
68 0.39
69 0.44
70 0.51
71 0.59
72 0.66
73 0.7
74 0.73
75 0.77
76 0.8
77 0.81
78 0.79
79 0.74
80 0.7
81 0.62
82 0.54
83 0.46
84 0.38
85 0.3
86 0.29
87 0.25
88 0.2
89 0.22
90 0.24
91 0.23
92 0.25
93 0.25
94 0.26
95 0.29
96 0.28
97 0.28
98 0.27
99 0.27
100 0.24
101 0.22
102 0.2