Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2GXT8

Protein Details
Accession A0A0G2GXT8    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
97-126AAQKIEKASRQQRKQRKNRSKEFRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
100-134KIEKASRQQRKQRKNRSKEFRGTAKTKGASKDKKK
Subcellular Location(s) mito 17, cyto 5.5, cyto_nucl 5.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADAPVTLRTRKFIRNSLLSRKQMVVDVLHPNRANVSKDELRGKLAEIYKANKDQVSVFGFRTQYGGGKSTGFALIYDSHEALKKFEPHYRQVRIGAAQKIEKASRQQRKQRKNRSKEFRGTAKTKGASKDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.57
3 0.63
4 0.68
5 0.73
6 0.69
7 0.66
8 0.59
9 0.52
10 0.45
11 0.4
12 0.31
13 0.26
14 0.32
15 0.3
16 0.34
17 0.33
18 0.31
19 0.32
20 0.33
21 0.31
22 0.23
23 0.29
24 0.27
25 0.31
26 0.36
27 0.33
28 0.32
29 0.3
30 0.29
31 0.27
32 0.25
33 0.26
34 0.23
35 0.26
36 0.28
37 0.3
38 0.3
39 0.24
40 0.24
41 0.2
42 0.21
43 0.21
44 0.19
45 0.17
46 0.19
47 0.19
48 0.18
49 0.18
50 0.14
51 0.13
52 0.12
53 0.13
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.07
61 0.07
62 0.08
63 0.09
64 0.1
65 0.1
66 0.1
67 0.12
68 0.13
69 0.13
70 0.15
71 0.18
72 0.2
73 0.25
74 0.28
75 0.34
76 0.42
77 0.45
78 0.44
79 0.43
80 0.43
81 0.42
82 0.44
83 0.41
84 0.36
85 0.33
86 0.31
87 0.32
88 0.31
89 0.29
90 0.32
91 0.39
92 0.46
93 0.54
94 0.63
95 0.7
96 0.8
97 0.88
98 0.9
99 0.91
100 0.92
101 0.93
102 0.93
103 0.93
104 0.92
105 0.89
106 0.88
107 0.86
108 0.79
109 0.74
110 0.72
111 0.67
112 0.63
113 0.62
114 0.63