Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O94588

Protein Details
Accession O94588   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-58RPLLCKKCRAIKQQLKSNLKCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 4, cyto 2.5, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0000785  C:chromatin  
GO:0005829  C:cytosol  
GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0010672  P:regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle  
KEGG spo:SPCC584.02  -  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS01119  COPPER_FIST_1  
PS50073  COPPER_FIST_2  
Amino Acid Sequences MIIIDGKNYACVVCLRGHRGSSCQHQERALIEVRTRGRPLLCKKCRAIKQQLKSNLKCVCHLQPFLPFANEYQELLNFTQKNPILASLFLFSTDKDIMNSSLNPASQAYTFDLGRTLPISEDILGYRKPLSLTDASNRIDASQLNEKENDSFTINQEADIFNFAKYLHSKDDISGIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.29
4 0.32
5 0.32
6 0.35
7 0.39
8 0.43
9 0.49
10 0.49
11 0.48
12 0.47
13 0.48
14 0.45
15 0.44
16 0.39
17 0.31
18 0.26
19 0.31
20 0.33
21 0.34
22 0.34
23 0.32
24 0.3
25 0.36
26 0.45
27 0.5
28 0.53
29 0.56
30 0.61
31 0.67
32 0.73
33 0.73
34 0.74
35 0.73
36 0.75
37 0.77
38 0.82
39 0.82
40 0.75
41 0.74
42 0.68
43 0.6
44 0.53
45 0.48
46 0.44
47 0.4
48 0.4
49 0.33
50 0.32
51 0.34
52 0.32
53 0.29
54 0.22
55 0.17
56 0.2
57 0.19
58 0.15
59 0.13
60 0.12
61 0.13
62 0.14
63 0.18
64 0.14
65 0.14
66 0.19
67 0.19
68 0.19
69 0.17
70 0.18
71 0.14
72 0.13
73 0.14
74 0.09
75 0.09
76 0.08
77 0.08
78 0.07
79 0.09
80 0.09
81 0.09
82 0.08
83 0.09
84 0.1
85 0.11
86 0.11
87 0.11
88 0.11
89 0.11
90 0.11
91 0.11
92 0.11
93 0.09
94 0.11
95 0.11
96 0.11
97 0.11
98 0.11
99 0.11
100 0.1
101 0.1
102 0.09
103 0.08
104 0.06
105 0.07
106 0.08
107 0.08
108 0.09
109 0.09
110 0.11
111 0.11
112 0.12
113 0.11
114 0.12
115 0.12
116 0.12
117 0.16
118 0.16
119 0.19
120 0.24
121 0.29
122 0.29
123 0.3
124 0.29
125 0.25
126 0.23
127 0.2
128 0.21
129 0.24
130 0.25
131 0.26
132 0.27
133 0.28
134 0.28
135 0.29
136 0.26
137 0.2
138 0.19
139 0.19
140 0.26
141 0.25
142 0.23
143 0.23
144 0.22
145 0.19
146 0.21
147 0.19
148 0.12
149 0.13
150 0.12
151 0.16
152 0.18
153 0.21
154 0.23
155 0.26
156 0.27
157 0.27