Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2EAT9

Protein Details
Accession A0A0G2EAT9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
305-326AARARLKLKAEERRKRGGREDEBasic
NLS Segment(s)
PositionSequence
305-323AARARLKLKAEERRKRGGR
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021589  Cut12  
Pfam View protein in Pfam  
PF11500  Cut12  
Amino Acid Sequences MVAFRDAPSRKLAADKSPANKEQLKKEEGLAQRRSDAAAGVESQSSPLRSTSRSPLKDIETQVSPSPKQRTSKLRHVQSPASTTKEHPRSRTSREATRAQAPCSPLPSRVRDKTSVLPPPPTTSTEPTITSSKSHSYRTHSDRQLRKLLRRYDLVKSYARMKDEEANEMSLRVKQLEEENRNLLKELQQLKDSVALKSGDLEIPNPPRTKETRNRIPETRWKFTGPTTGTINSTETTRRQHLLNQTHPFNKLSDKPTTDLQEKSLPLDFDFDTPAAAAAAAATTTTTATALSAKVPNLPPDRLAAARARLKLKAEERRKRGGREDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.52
4 0.58
5 0.6
6 0.59
7 0.63
8 0.61
9 0.62
10 0.63
11 0.59
12 0.52
13 0.52
14 0.54
15 0.55
16 0.58
17 0.53
18 0.48
19 0.45
20 0.44
21 0.43
22 0.34
23 0.27
24 0.2
25 0.16
26 0.15
27 0.14
28 0.14
29 0.13
30 0.14
31 0.15
32 0.14
33 0.14
34 0.15
35 0.16
36 0.18
37 0.23
38 0.32
39 0.4
40 0.42
41 0.45
42 0.47
43 0.49
44 0.53
45 0.52
46 0.46
47 0.39
48 0.39
49 0.39
50 0.39
51 0.36
52 0.36
53 0.4
54 0.41
55 0.43
56 0.48
57 0.54
58 0.57
59 0.67
60 0.7
61 0.71
62 0.73
63 0.74
64 0.72
65 0.66
66 0.64
67 0.57
68 0.51
69 0.44
70 0.4
71 0.45
72 0.48
73 0.48
74 0.46
75 0.51
76 0.54
77 0.6
78 0.67
79 0.62
80 0.61
81 0.62
82 0.64
83 0.59
84 0.62
85 0.57
86 0.49
87 0.47
88 0.42
89 0.38
90 0.36
91 0.34
92 0.3
93 0.32
94 0.37
95 0.41
96 0.43
97 0.47
98 0.45
99 0.48
100 0.49
101 0.51
102 0.52
103 0.47
104 0.45
105 0.42
106 0.42
107 0.41
108 0.38
109 0.34
110 0.29
111 0.3
112 0.28
113 0.28
114 0.27
115 0.27
116 0.24
117 0.21
118 0.2
119 0.23
120 0.23
121 0.27
122 0.28
123 0.32
124 0.39
125 0.45
126 0.52
127 0.53
128 0.59
129 0.61
130 0.63
131 0.67
132 0.63
133 0.64
134 0.63
135 0.62
136 0.57
137 0.54
138 0.52
139 0.49
140 0.48
141 0.45
142 0.39
143 0.34
144 0.37
145 0.35
146 0.32
147 0.27
148 0.24
149 0.27
150 0.26
151 0.28
152 0.22
153 0.21
154 0.19
155 0.19
156 0.18
157 0.13
158 0.12
159 0.09
160 0.08
161 0.08
162 0.14
163 0.22
164 0.25
165 0.26
166 0.31
167 0.31
168 0.31
169 0.31
170 0.26
171 0.2
172 0.24
173 0.26
174 0.23
175 0.23
176 0.24
177 0.24
178 0.29
179 0.28
180 0.2
181 0.18
182 0.17
183 0.15
184 0.16
185 0.16
186 0.11
187 0.11
188 0.12
189 0.13
190 0.18
191 0.23
192 0.23
193 0.22
194 0.25
195 0.29
196 0.38
197 0.42
198 0.48
199 0.53
200 0.61
201 0.67
202 0.67
203 0.69
204 0.7
205 0.69
206 0.65
207 0.58
208 0.51
209 0.47
210 0.44
211 0.46
212 0.38
213 0.33
214 0.31
215 0.3
216 0.29
217 0.29
218 0.28
219 0.19
220 0.19
221 0.18
222 0.18
223 0.21
224 0.24
225 0.24
226 0.24
227 0.3
228 0.38
229 0.44
230 0.5
231 0.52
232 0.54
233 0.56
234 0.57
235 0.52
236 0.44
237 0.4
238 0.38
239 0.35
240 0.37
241 0.37
242 0.37
243 0.41
244 0.45
245 0.44
246 0.38
247 0.37
248 0.36
249 0.34
250 0.34
251 0.32
252 0.27
253 0.24
254 0.26
255 0.23
256 0.18
257 0.2
258 0.17
259 0.13
260 0.12
261 0.12
262 0.09
263 0.08
264 0.06
265 0.04
266 0.04
267 0.04
268 0.04
269 0.03
270 0.04
271 0.04
272 0.04
273 0.05
274 0.04
275 0.05
276 0.07
277 0.08
278 0.11
279 0.14
280 0.14
281 0.2
282 0.23
283 0.3
284 0.34
285 0.35
286 0.33
287 0.33
288 0.37
289 0.32
290 0.33
291 0.3
292 0.33
293 0.38
294 0.42
295 0.43
296 0.42
297 0.45
298 0.5
299 0.55
300 0.58
301 0.62
302 0.67
303 0.7
304 0.78
305 0.81
306 0.8