Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O94327

Protein Details
Accession O94327    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
30-51GNSYKPRKDYENKKQPKFHPPAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, mito 6, nucl 1, plas 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR038330  TspO/MBR-related_sf  
IPR004307  TspO_MBR  
Gene Ontology GO:0005741  C:mitochondrial outer membrane  
GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF03073  TspO_MBR  
CDD cd15904  TSPO_MBR  
Amino Acid Sequences MDLNYQVFTSISKNWWSASLVPVACGWFIGNSYKPRKDYENKKQPKFHPPASAFGPAWTLLYLTMGYASHLAYKADPLMITNASRNGSILYIAQLAANFAWMPLFYGLAKPKLALADLGILTGLVGWLAKTWWPLAPTASKWLIPYLAWLGYAGYLNLGYCLLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.24
4 0.23
5 0.23
6 0.26
7 0.23
8 0.23
9 0.23
10 0.21
11 0.18
12 0.16
13 0.14
14 0.07
15 0.08
16 0.11
17 0.16
18 0.23
19 0.31
20 0.36
21 0.38
22 0.41
23 0.48
24 0.54
25 0.6
26 0.63
27 0.67
28 0.72
29 0.78
30 0.83
31 0.81
32 0.82
33 0.79
34 0.73
35 0.72
36 0.64
37 0.61
38 0.56
39 0.55
40 0.44
41 0.36
42 0.32
43 0.21
44 0.2
45 0.15
46 0.11
47 0.06
48 0.07
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.06
56 0.06
57 0.07
58 0.07
59 0.06
60 0.07
61 0.07
62 0.07
63 0.06
64 0.06
65 0.07
66 0.07
67 0.08
68 0.08
69 0.1
70 0.1
71 0.1
72 0.1
73 0.09
74 0.08
75 0.08
76 0.07
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.05
84 0.05
85 0.04
86 0.04
87 0.04
88 0.03
89 0.05
90 0.05
91 0.05
92 0.05
93 0.09
94 0.11
95 0.13
96 0.14
97 0.12
98 0.13
99 0.13
100 0.14
101 0.1
102 0.09
103 0.1
104 0.1
105 0.1
106 0.09
107 0.08
108 0.07
109 0.07
110 0.06
111 0.02
112 0.02
113 0.02
114 0.03
115 0.04
116 0.05
117 0.06
118 0.08
119 0.1
120 0.11
121 0.12
122 0.15
123 0.2
124 0.21
125 0.26
126 0.27
127 0.26
128 0.26
129 0.27
130 0.25
131 0.2
132 0.22
133 0.18
134 0.17
135 0.16
136 0.15
137 0.14
138 0.13
139 0.14
140 0.1
141 0.08
142 0.08
143 0.07
144 0.08