Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9SUV1

Protein Details
Accession A0A0C9SUV1   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
147-170RVCAHRRPPRLRPRTPRSPRLRTPBasic
176-209SSARRTPSCVRAHRRPRPPRSRAPRSPRSRTATPHydrophilic
NLS Segment(s)
PositionSequence
152-205RRPPRLRPRTPRSPRLRTPTPSPSSSARRTPSCVRAHRRPRPPRSRAPRSPRSR
Subcellular Location(s) nucl 16, cyto 5, mito 3, extr 3
Family & Domain DBs
Amino Acid Sequences MSGMAGMACFEGFQAPAMGTHTGLPRKIIPGRRDTLRLTAHPPHPRGGFLSAAPRCMVGPATTTTTPTSAFTRTTTAAAAATFTRTAAMYCGRRQHARASPALARPLPAHTHHLRIHAQHPHPPRLRTPSPPAFAHTHAFARPDALRVCAHRRPPRLRPRTPRSPRLRTPTPSPSSSARRTPSCVRAHRRPRPPRSRAPRSPRSRTATPSTSAHPTPSASAHPSPSAFAHSHAHALRVCARTRAHPPCLRTPTLYVFAHALATCVCAQPHPACLRTPLPPPSAHTLRVHLHTLRAPAPFAHIPTSSKEKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.11
5 0.12
6 0.11
7 0.14
8 0.2
9 0.23
10 0.24
11 0.25
12 0.26
13 0.32
14 0.39
15 0.44
16 0.43
17 0.48
18 0.53
19 0.56
20 0.58
21 0.54
22 0.55
23 0.53
24 0.5
25 0.48
26 0.51
27 0.54
28 0.58
29 0.57
30 0.55
31 0.5
32 0.48
33 0.44
34 0.39
35 0.32
36 0.26
37 0.33
38 0.28
39 0.29
40 0.27
41 0.24
42 0.21
43 0.2
44 0.19
45 0.1
46 0.12
47 0.13
48 0.18
49 0.18
50 0.2
51 0.2
52 0.2
53 0.2
54 0.19
55 0.19
56 0.16
57 0.17
58 0.17
59 0.19
60 0.19
61 0.19
62 0.18
63 0.16
64 0.15
65 0.13
66 0.13
67 0.1
68 0.1
69 0.09
70 0.08
71 0.08
72 0.08
73 0.08
74 0.09
75 0.14
76 0.17
77 0.2
78 0.27
79 0.3
80 0.33
81 0.35
82 0.41
83 0.43
84 0.43
85 0.42
86 0.4
87 0.41
88 0.42
89 0.44
90 0.36
91 0.3
92 0.27
93 0.27
94 0.25
95 0.22
96 0.26
97 0.23
98 0.3
99 0.31
100 0.35
101 0.34
102 0.34
103 0.38
104 0.4
105 0.4
106 0.41
107 0.45
108 0.49
109 0.51
110 0.51
111 0.49
112 0.49
113 0.51
114 0.49
115 0.52
116 0.5
117 0.5
118 0.48
119 0.47
120 0.42
121 0.4
122 0.36
123 0.28
124 0.23
125 0.19
126 0.2
127 0.16
128 0.16
129 0.14
130 0.15
131 0.14
132 0.14
133 0.15
134 0.16
135 0.23
136 0.24
137 0.32
138 0.37
139 0.45
140 0.49
141 0.58
142 0.66
143 0.7
144 0.75
145 0.77
146 0.78
147 0.81
148 0.83
149 0.83
150 0.81
151 0.8
152 0.78
153 0.76
154 0.75
155 0.67
156 0.66
157 0.66
158 0.6
159 0.53
160 0.49
161 0.46
162 0.45
163 0.46
164 0.45
165 0.39
166 0.37
167 0.41
168 0.43
169 0.46
170 0.48
171 0.53
172 0.55
173 0.61
174 0.7
175 0.75
176 0.8
177 0.82
178 0.84
179 0.86
180 0.86
181 0.87
182 0.87
183 0.88
184 0.87
185 0.86
186 0.86
187 0.84
188 0.85
189 0.83
190 0.8
191 0.74
192 0.69
193 0.67
194 0.6
195 0.54
196 0.48
197 0.42
198 0.4
199 0.36
200 0.32
201 0.25
202 0.22
203 0.2
204 0.2
205 0.19
206 0.19
207 0.2
208 0.21
209 0.21
210 0.21
211 0.21
212 0.19
213 0.21
214 0.17
215 0.18
216 0.19
217 0.18
218 0.23
219 0.22
220 0.24
221 0.21
222 0.23
223 0.27
224 0.28
225 0.29
226 0.28
227 0.29
228 0.32
229 0.41
230 0.46
231 0.49
232 0.5
233 0.54
234 0.59
235 0.64
236 0.62
237 0.55
238 0.51
239 0.47
240 0.49
241 0.44
242 0.35
243 0.3
244 0.27
245 0.26
246 0.22
247 0.17
248 0.1
249 0.12
250 0.12
251 0.12
252 0.12
253 0.1
254 0.14
255 0.15
256 0.23
257 0.25
258 0.26
259 0.26
260 0.31
261 0.34
262 0.35
263 0.41
264 0.39
265 0.39
266 0.39
267 0.42
268 0.47
269 0.47
270 0.47
271 0.42
272 0.42
273 0.43
274 0.45
275 0.45
276 0.38
277 0.38
278 0.37
279 0.39
280 0.37
281 0.34
282 0.32
283 0.27
284 0.32
285 0.31
286 0.29
287 0.29
288 0.27
289 0.27
290 0.32
291 0.4