Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2TRK9

Protein Details
Accession G2TRK9   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-28VLSICSSKSKEKKVVNEKPTVKPKPHydrophilic
NLS Segment(s)
PositionSequence
24-29VKPKPA
34-42KPAKAITKA
75-99EKRNIEKKKGNGKLGRQLEKERAKP
Subcellular Location(s) nucl 21, cyto_nucl 12.833, mito_nucl 12.333, cyto 3.5
Family & Domain DBs
Gene Ontology GO:0005886  C:plasma membrane  
Amino Acid Sequences MGQVLSICSSKSKEKKVVNEKPTVKPKPAVNVQKPAKAITKASSPPRTGRKLAETGNTSNKEHLSPTEAARVAAEKRNIEKKKGNGKLGRQLEKERAKPMKEHLQDISTQRQQEREQIKWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.65
3 0.73
4 0.8
5 0.77
6 0.79
7 0.77
8 0.77
9 0.8
10 0.74
11 0.67
12 0.62
13 0.59
14 0.58
15 0.61
16 0.62
17 0.58
18 0.63
19 0.63
20 0.62
21 0.6
22 0.54
23 0.49
24 0.4
25 0.36
26 0.29
27 0.31
28 0.32
29 0.39
30 0.42
31 0.39
32 0.43
33 0.49
34 0.51
35 0.47
36 0.44
37 0.41
38 0.4
39 0.4
40 0.39
41 0.35
42 0.33
43 0.38
44 0.37
45 0.33
46 0.3
47 0.28
48 0.23
49 0.21
50 0.18
51 0.15
52 0.14
53 0.15
54 0.18
55 0.18
56 0.18
57 0.17
58 0.18
59 0.16
60 0.19
61 0.21
62 0.18
63 0.22
64 0.33
65 0.35
66 0.39
67 0.43
68 0.47
69 0.55
70 0.61
71 0.65
72 0.62
73 0.66
74 0.7
75 0.72
76 0.71
77 0.64
78 0.62
79 0.62
80 0.64
81 0.62
82 0.61
83 0.59
84 0.54
85 0.53
86 0.56
87 0.57
88 0.53
89 0.53
90 0.47
91 0.43
92 0.45
93 0.46
94 0.48
95 0.43
96 0.43
97 0.41
98 0.43
99 0.43
100 0.48
101 0.5