Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9T3I2

Protein Details
Accession A0A0C9T3I2   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
166-191SQSFVRRKSPQRLKAKMRTRWKNAGPHydrophilic
NLS Segment(s)
PositionSequence
171-188RRKSPQRLKAKMRTRWKN
Subcellular Location(s) cyto 17, cyto_nucl 11.833, cyto_mito 11.499, mito 4.5, nucl 3.5
Family & Domain DBs
CDD cd00303  retropepsin_like  
Amino Acid Sequences VYPPKVRSVPEGLSSVGVASLHILARLGSQTAEPIKHRLDSGADITLISSDQYEVLPEKPPLKQGLRMKLYHLTGDAAILGYIRTTIYVVSDCGRTLGFDVEAYVVKNMRVPILLGEDFQVAYELGVLRDAESGTRVTVGKTGYSIKASSSTAEDLGFECRYAHLSQSFVRRKSPQRLKAKMRTRWKNAGPPPVRAEGDTVIPAGTAWMVKIGGPFAGRDDWLIEGLVLSQEDGSLLAAPTTWIRSEDPRIPIANPSGSPWIIKKGDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.23
3 0.17
4 0.13
5 0.09
6 0.08
7 0.09
8 0.08
9 0.08
10 0.08
11 0.07
12 0.09
13 0.1
14 0.1
15 0.08
16 0.08
17 0.13
18 0.16
19 0.2
20 0.2
21 0.24
22 0.26
23 0.27
24 0.28
25 0.25
26 0.24
27 0.24
28 0.25
29 0.22
30 0.2
31 0.18
32 0.17
33 0.16
34 0.13
35 0.1
36 0.07
37 0.05
38 0.06
39 0.06
40 0.07
41 0.08
42 0.1
43 0.13
44 0.15
45 0.18
46 0.19
47 0.23
48 0.27
49 0.29
50 0.36
51 0.4
52 0.48
53 0.51
54 0.5
55 0.5
56 0.5
57 0.48
58 0.41
59 0.33
60 0.25
61 0.19
62 0.18
63 0.15
64 0.09
65 0.07
66 0.06
67 0.05
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.06
76 0.07
77 0.08
78 0.09
79 0.09
80 0.09
81 0.09
82 0.08
83 0.08
84 0.09
85 0.07
86 0.07
87 0.07
88 0.08
89 0.08
90 0.08
91 0.08
92 0.07
93 0.07
94 0.09
95 0.09
96 0.09
97 0.08
98 0.08
99 0.08
100 0.12
101 0.12
102 0.1
103 0.11
104 0.11
105 0.1
106 0.1
107 0.09
108 0.05
109 0.05
110 0.05
111 0.04
112 0.04
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.06
121 0.05
122 0.07
123 0.07
124 0.06
125 0.09
126 0.09
127 0.08
128 0.09
129 0.11
130 0.11
131 0.12
132 0.12
133 0.1
134 0.12
135 0.12
136 0.12
137 0.12
138 0.11
139 0.11
140 0.11
141 0.1
142 0.09
143 0.11
144 0.1
145 0.09
146 0.08
147 0.08
148 0.1
149 0.1
150 0.12
151 0.1
152 0.12
153 0.15
154 0.25
155 0.32
156 0.31
157 0.35
158 0.4
159 0.46
160 0.55
161 0.62
162 0.62
163 0.66
164 0.74
165 0.79
166 0.83
167 0.85
168 0.84
169 0.84
170 0.84
171 0.82
172 0.81
173 0.78
174 0.78
175 0.75
176 0.76
177 0.69
178 0.64
179 0.6
180 0.56
181 0.5
182 0.41
183 0.36
184 0.27
185 0.25
186 0.21
187 0.17
188 0.11
189 0.11
190 0.1
191 0.07
192 0.06
193 0.05
194 0.04
195 0.05
196 0.05
197 0.06
198 0.07
199 0.07
200 0.08
201 0.09
202 0.09
203 0.1
204 0.11
205 0.11
206 0.11
207 0.12
208 0.11
209 0.11
210 0.11
211 0.09
212 0.07
213 0.08
214 0.08
215 0.07
216 0.06
217 0.05
218 0.05
219 0.05
220 0.05
221 0.05
222 0.06
223 0.06
224 0.05
225 0.06
226 0.07
227 0.08
228 0.1
229 0.1
230 0.11
231 0.14
232 0.2
233 0.27
234 0.33
235 0.36
236 0.38
237 0.39
238 0.38
239 0.41
240 0.4
241 0.37
242 0.31
243 0.31
244 0.32
245 0.3
246 0.31
247 0.29
248 0.33