Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9T933

Protein Details
Accession A0A0C9T933   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-77SYPSPKLQPRHKSTPRPCTPHHydrophilic
123-144RPPHPLRPPRHSRPRLPFHNPCBasic
146-171RPLHPRSPSPLRPRIRRTRPSPQASGHydrophilic
NLS Segment(s)
PositionSequence
122-197PRPPHPLRPPRHSRPRLPFHNPCARPLHPRSPSPLRPRIRRTRPSPQASGGRSRRAPLFRRTLRATRRLATRSWRR
Subcellular Location(s) mito 14, nucl 8.5, cyto_nucl 6, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MHMRYSGHWVRFAFNFLMRQTNNGWPGPPSMDRPFDALWPNFRHLYSLPSFSHPIISYPSPKLQPRHKSTPRPCTPHKNIPPVASRFPTLRPLWRTSHSSTSSPRSYRTTTARKTPAVNLAPRPPHPLRPPRHSRPRLPFHNPCARPLHPRSPSPLRPRIRRTRPSPQASGGRSRRAPLFRRTLRATRRLATRSWRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.27
4 0.34
5 0.31
6 0.32
7 0.32
8 0.37
9 0.37
10 0.34
11 0.33
12 0.27
13 0.29
14 0.31
15 0.29
16 0.28
17 0.29
18 0.32
19 0.31
20 0.34
21 0.32
22 0.31
23 0.35
24 0.31
25 0.33
26 0.33
27 0.36
28 0.34
29 0.33
30 0.32
31 0.26
32 0.3
33 0.26
34 0.28
35 0.26
36 0.27
37 0.3
38 0.27
39 0.3
40 0.24
41 0.22
42 0.21
43 0.22
44 0.23
45 0.24
46 0.28
47 0.29
48 0.34
49 0.39
50 0.44
51 0.52
52 0.56
53 0.64
54 0.68
55 0.74
56 0.79
57 0.83
58 0.82
59 0.8
60 0.78
61 0.77
62 0.76
63 0.76
64 0.75
65 0.73
66 0.67
67 0.65
68 0.65
69 0.59
70 0.54
71 0.45
72 0.38
73 0.31
74 0.29
75 0.31
76 0.26
77 0.28
78 0.28
79 0.31
80 0.33
81 0.35
82 0.38
83 0.35
84 0.4
85 0.37
86 0.35
87 0.34
88 0.37
89 0.39
90 0.35
91 0.34
92 0.31
93 0.31
94 0.33
95 0.38
96 0.41
97 0.4
98 0.47
99 0.49
100 0.47
101 0.47
102 0.45
103 0.46
104 0.41
105 0.41
106 0.36
107 0.38
108 0.39
109 0.38
110 0.43
111 0.37
112 0.4
113 0.44
114 0.5
115 0.51
116 0.57
117 0.66
118 0.68
119 0.77
120 0.78
121 0.79
122 0.79
123 0.82
124 0.81
125 0.81
126 0.78
127 0.75
128 0.79
129 0.71
130 0.65
131 0.62
132 0.56
133 0.56
134 0.55
135 0.57
136 0.52
137 0.53
138 0.56
139 0.59
140 0.65
141 0.66
142 0.68
143 0.67
144 0.71
145 0.78
146 0.81
147 0.82
148 0.83
149 0.83
150 0.84
151 0.86
152 0.84
153 0.79
154 0.76
155 0.74
156 0.68
157 0.7
158 0.65
159 0.63
160 0.57
161 0.55
162 0.55
163 0.55
164 0.57
165 0.55
166 0.6
167 0.59
168 0.65
169 0.69
170 0.71
171 0.72
172 0.75
173 0.72
174 0.68
175 0.71
176 0.66
177 0.64