Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O74558

Protein Details
Accession O74558   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-25NSLSRITRGNRSKRHQNLSDAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 4, nucl 2, plas 1, extr 1, pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR005301  MOB_kinase_act_fam  
IPR036703  MOB_kinase_act_sf  
Gene Ontology GO:0005938  C:cell cortex  
GO:0032153  C:cell division site  
GO:0051286  C:cell tip  
GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0030295  F:protein kinase activator activity  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
GO:0001934  P:positive regulation of protein phosphorylation  
GO:0062200  P:RAM/MOR signaling pathway  
GO:2000100  P:regulation of establishment or maintenance of bipolar cell polarity regulating cell shape  
GO:0007165  P:signal transduction  
KEGG spo:SPCC970.04c  -  
Pfam View protein in Pfam  
PF03637  Mob1_phocein  
Amino Acid Sequences MFLLNSLSRITRGNRSKRHQNLSDASSSSGSFSKKSSTSQLVRTGSPSVEPTALYLQQPFVRTHLVKGNFSTIVSLPRFVDLDEWVALNVYELFTYLNHFYDVFATFCTVKTCPVMSAAANFDYTWLDNNRKPVHLPAPQYIEYVLAWIENRLHDQNVFPTKAGLPFPSNFLVIVKAIYKQMFRIFAHMYYAHYAEILHLSLEAHWNSFFAHFIAFGKEFQLLDKRDTAPLKDLIVVLENQGNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.74
4 0.79
5 0.85
6 0.81
7 0.8
8 0.77
9 0.72
10 0.68
11 0.58
12 0.51
13 0.42
14 0.36
15 0.29
16 0.25
17 0.21
18 0.17
19 0.17
20 0.2
21 0.21
22 0.24
23 0.29
24 0.35
25 0.38
26 0.43
27 0.5
28 0.48
29 0.46
30 0.46
31 0.41
32 0.33
33 0.3
34 0.26
35 0.19
36 0.17
37 0.16
38 0.16
39 0.17
40 0.18
41 0.17
42 0.16
43 0.16
44 0.19
45 0.21
46 0.19
47 0.18
48 0.23
49 0.23
50 0.25
51 0.3
52 0.31
53 0.3
54 0.31
55 0.33
56 0.26
57 0.26
58 0.25
59 0.18
60 0.2
61 0.19
62 0.19
63 0.15
64 0.16
65 0.16
66 0.14
67 0.15
68 0.1
69 0.11
70 0.1
71 0.1
72 0.09
73 0.08
74 0.08
75 0.07
76 0.06
77 0.04
78 0.04
79 0.04
80 0.05
81 0.04
82 0.07
83 0.08
84 0.08
85 0.08
86 0.08
87 0.08
88 0.1
89 0.11
90 0.09
91 0.08
92 0.09
93 0.09
94 0.09
95 0.11
96 0.09
97 0.09
98 0.1
99 0.1
100 0.09
101 0.11
102 0.11
103 0.09
104 0.11
105 0.11
106 0.1
107 0.1
108 0.1
109 0.09
110 0.08
111 0.08
112 0.09
113 0.1
114 0.13
115 0.14
116 0.21
117 0.22
118 0.22
119 0.23
120 0.25
121 0.29
122 0.31
123 0.33
124 0.3
125 0.34
126 0.34
127 0.33
128 0.29
129 0.24
130 0.18
131 0.15
132 0.11
133 0.06
134 0.06
135 0.06
136 0.07
137 0.06
138 0.09
139 0.1
140 0.11
141 0.11
142 0.12
143 0.18
144 0.23
145 0.23
146 0.2
147 0.2
148 0.21
149 0.23
150 0.23
151 0.19
152 0.17
153 0.16
154 0.19
155 0.19
156 0.19
157 0.16
158 0.15
159 0.14
160 0.11
161 0.12
162 0.09
163 0.09
164 0.12
165 0.13
166 0.13
167 0.15
168 0.18
169 0.23
170 0.22
171 0.25
172 0.25
173 0.24
174 0.28
175 0.26
176 0.24
177 0.21
178 0.21
179 0.17
180 0.14
181 0.14
182 0.11
183 0.11
184 0.1
185 0.07
186 0.07
187 0.07
188 0.08
189 0.13
190 0.12
191 0.12
192 0.12
193 0.12
194 0.13
195 0.13
196 0.13
197 0.09
198 0.09
199 0.09
200 0.1
201 0.14
202 0.14
203 0.14
204 0.15
205 0.16
206 0.16
207 0.18
208 0.25
209 0.22
210 0.25
211 0.3
212 0.3
213 0.35
214 0.38
215 0.38
216 0.35
217 0.36
218 0.34
219 0.31
220 0.3
221 0.24
222 0.24
223 0.21
224 0.18