Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9SVX6

Protein Details
Accession A0A0C9SVX6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
177-203VAECKLWERVQRKKRAHELARVRERRFHydrophilic
NLS Segment(s)
PositionSequence
189-193KKRAH
Subcellular Location(s) nucl 10, cyto 7, mito_nucl 7, mito 4, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
PROSITE View protein in PROSITE  
PS50181  FBOX  
Amino Acid Sequences MPVEILFEIFGWTRPEDLLCLIRTSKPIRSLLLHRRTALSTWKAAFERHYPDIPDCPPGLNEPQYARLMCSRECHGDCEGTAGEGETRVFWWFCVRYCQPCLEKRVVYHVDSKAPYYFCVPLEYVLPTAPDSHGRRQYLLGDVEGFNRQLDALPPGEEREAFVKREEGRMRDLHVHVAECKLWERVQRKKRAHELARVRERRFDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.17
5 0.19
6 0.18
7 0.2
8 0.21
9 0.23
10 0.28
11 0.3
12 0.33
13 0.35
14 0.36
15 0.36
16 0.4
17 0.47
18 0.52
19 0.57
20 0.56
21 0.51
22 0.51
23 0.49
24 0.46
25 0.45
26 0.38
27 0.34
28 0.31
29 0.34
30 0.32
31 0.32
32 0.33
33 0.3
34 0.33
35 0.32
36 0.33
37 0.31
38 0.32
39 0.36
40 0.33
41 0.31
42 0.25
43 0.22
44 0.2
45 0.21
46 0.23
47 0.21
48 0.22
49 0.2
50 0.24
51 0.25
52 0.24
53 0.23
54 0.22
55 0.23
56 0.22
57 0.23
58 0.22
59 0.26
60 0.27
61 0.28
62 0.26
63 0.24
64 0.22
65 0.22
66 0.19
67 0.13
68 0.12
69 0.09
70 0.08
71 0.07
72 0.07
73 0.04
74 0.05
75 0.06
76 0.06
77 0.06
78 0.09
79 0.1
80 0.11
81 0.17
82 0.19
83 0.22
84 0.24
85 0.29
86 0.3
87 0.33
88 0.37
89 0.34
90 0.33
91 0.3
92 0.36
93 0.34
94 0.31
95 0.32
96 0.3
97 0.3
98 0.29
99 0.3
100 0.25
101 0.22
102 0.21
103 0.18
104 0.18
105 0.14
106 0.16
107 0.15
108 0.12
109 0.13
110 0.13
111 0.12
112 0.1
113 0.1
114 0.08
115 0.09
116 0.09
117 0.15
118 0.18
119 0.25
120 0.31
121 0.32
122 0.33
123 0.33
124 0.34
125 0.32
126 0.29
127 0.22
128 0.18
129 0.17
130 0.18
131 0.18
132 0.16
133 0.12
134 0.1
135 0.1
136 0.08
137 0.09
138 0.1
139 0.1
140 0.11
141 0.12
142 0.13
143 0.14
144 0.13
145 0.14
146 0.16
147 0.18
148 0.17
149 0.18
150 0.23
151 0.23
152 0.32
153 0.35
154 0.33
155 0.36
156 0.37
157 0.4
158 0.41
159 0.41
160 0.38
161 0.36
162 0.35
163 0.31
164 0.31
165 0.28
166 0.23
167 0.24
168 0.21
169 0.21
170 0.28
171 0.34
172 0.42
173 0.51
174 0.6
175 0.66
176 0.73
177 0.81
178 0.84
179 0.84
180 0.84
181 0.85
182 0.85
183 0.88
184 0.86
185 0.78