Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O59865

Protein Details
Accession O59865    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
96-126QAEPIQKVARQQRKQRKNRGKKVFGTGKRLAHydrophilic
NLS Segment(s)
PositionSequence
104-131ARQQRKQRKNRGKKVFGTGKRLAKRKSK
Subcellular Location(s) mito 20, cyto 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:0005829  C:cytosol  
GO:0022627  C:cytosolic small ribosomal subunit  
GO:0005730  C:nucleolus  
GO:0003735  F:structural constituent of ribosome  
GO:0002182  P:cytoplasmic translational elongation  
GO:0006364  P:rRNA processing  
KEGG spo:SPBC17G9.07  -  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSEAVTIRTRKFMTNRLLQRKQMVVDILHPGKANLSKNEIREKLAQMYKTDSECVQAFGLRTHFGGGRSTGFALIYDSTESMKKFEPHYRLVRVGQAEPIQKVARQQRKQRKNRGKKVFGTGKRLAKRKSKQQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.62
3 0.66
4 0.71
5 0.69
6 0.69
7 0.64
8 0.57
9 0.51
10 0.43
11 0.33
12 0.3
13 0.34
14 0.29
15 0.27
16 0.25
17 0.22
18 0.22
19 0.26
20 0.27
21 0.21
22 0.27
23 0.29
24 0.33
25 0.42
26 0.4
27 0.39
28 0.39
29 0.39
30 0.39
31 0.4
32 0.38
33 0.3
34 0.33
35 0.32
36 0.3
37 0.28
38 0.21
39 0.19
40 0.18
41 0.18
42 0.14
43 0.12
44 0.12
45 0.12
46 0.13
47 0.1
48 0.1
49 0.1
50 0.1
51 0.1
52 0.11
53 0.1
54 0.1
55 0.1
56 0.1
57 0.09
58 0.08
59 0.07
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.07
66 0.09
67 0.09
68 0.1
69 0.12
70 0.14
71 0.17
72 0.24
73 0.28
74 0.33
75 0.39
76 0.42
77 0.43
78 0.42
79 0.43
80 0.39
81 0.35
82 0.32
83 0.3
84 0.28
85 0.25
86 0.28
87 0.24
88 0.22
89 0.28
90 0.34
91 0.41
92 0.47
93 0.57
94 0.65
95 0.75
96 0.84
97 0.89
98 0.9
99 0.91
100 0.94
101 0.94
102 0.92
103 0.88
104 0.88
105 0.88
106 0.83
107 0.81
108 0.78
109 0.77
110 0.76
111 0.77
112 0.74
113 0.74
114 0.77