Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q9UTF7

Protein Details
Accession Q9UTF7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
282-305YINTYIKRGAKKNQRKAAGKADNTHydrophilic
NLS Segment(s)
PositionSequence
290-297GAKKNQRK
Subcellular Location(s) plas 21, vacu 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002076  ELO_fam  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0031965  C:nuclear membrane  
GO:0009922  F:fatty acid elongase activity  
GO:0102756  F:very-long-chain 3-ketoacyl-CoA synthase activity  
GO:0034625  P:fatty acid elongation, monounsaturated fatty acid  
GO:0034626  P:fatty acid elongation, polyunsaturated fatty acid  
GO:0019367  P:fatty acid elongation, saturated fatty acid  
GO:0071763  P:nuclear membrane organization  
GO:0030148  P:sphingolipid biosynthetic process  
GO:0042761  P:very long-chain fatty acid biosynthetic process  
KEGG spo:SPAC1B2.03c  -  
Pfam View protein in Pfam  
PF01151  ELO  
Amino Acid Sequences MDLTGAHMLKIHRPSIDHPFGVDLWHLFEQLSIKTIGWNPSEFEYIPGKTPMSQWSSVIVSITAYYVIILSGRAIMTNRKPLKQRRLFQLHNFILTIISGALLALLVEEVFRNYMRNGLFYCVCDSRHFTQRLVTLYYLNYLTKYLELMDTVFLFLKKKPLAFLHCYHHGITALLCFTQLLGRTSVQWGVIGLNLYVHVIMYSYYFLAACGRRVWWKQWVTRVQIIQFVLDLILCYFGTYSHIAFRYFPWLPHVGDCSGSLFAAFFGCGVLSSYLFLFIGFYINTYIKRGAKKNQRKAAGKADNTSVAAAAGSEALAATTATNASPFSARSRKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.42
3 0.47
4 0.4
5 0.36
6 0.36
7 0.34
8 0.33
9 0.29
10 0.2
11 0.18
12 0.18
13 0.17
14 0.14
15 0.15
16 0.16
17 0.15
18 0.17
19 0.13
20 0.12
21 0.16
22 0.2
23 0.24
24 0.24
25 0.25
26 0.25
27 0.26
28 0.29
29 0.25
30 0.25
31 0.24
32 0.23
33 0.25
34 0.25
35 0.23
36 0.21
37 0.23
38 0.26
39 0.27
40 0.27
41 0.25
42 0.26
43 0.27
44 0.26
45 0.24
46 0.18
47 0.12
48 0.11
49 0.11
50 0.08
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.04
57 0.04
58 0.06
59 0.06
60 0.07
61 0.08
62 0.14
63 0.18
64 0.28
65 0.32
66 0.36
67 0.45
68 0.54
69 0.64
70 0.68
71 0.71
72 0.71
73 0.77
74 0.77
75 0.77
76 0.78
77 0.68
78 0.6
79 0.53
80 0.42
81 0.32
82 0.26
83 0.19
84 0.08
85 0.06
86 0.04
87 0.04
88 0.03
89 0.03
90 0.03
91 0.02
92 0.02
93 0.02
94 0.02
95 0.03
96 0.03
97 0.04
98 0.05
99 0.06
100 0.06
101 0.11
102 0.11
103 0.13
104 0.13
105 0.16
106 0.17
107 0.16
108 0.2
109 0.18
110 0.19
111 0.19
112 0.23
113 0.24
114 0.32
115 0.32
116 0.29
117 0.31
118 0.34
119 0.34
120 0.32
121 0.28
122 0.21
123 0.19
124 0.2
125 0.18
126 0.14
127 0.12
128 0.1
129 0.09
130 0.08
131 0.08
132 0.07
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.07
140 0.07
141 0.08
142 0.08
143 0.13
144 0.14
145 0.14
146 0.16
147 0.19
148 0.24
149 0.28
150 0.31
151 0.31
152 0.34
153 0.35
154 0.33
155 0.3
156 0.25
157 0.2
158 0.16
159 0.12
160 0.08
161 0.07
162 0.06
163 0.05
164 0.05
165 0.06
166 0.07
167 0.07
168 0.09
169 0.09
170 0.1
171 0.11
172 0.12
173 0.11
174 0.09
175 0.08
176 0.07
177 0.08
178 0.07
179 0.06
180 0.05
181 0.05
182 0.05
183 0.05
184 0.04
185 0.03
186 0.03
187 0.03
188 0.04
189 0.04
190 0.04
191 0.05
192 0.05
193 0.05
194 0.09
195 0.09
196 0.1
197 0.11
198 0.12
199 0.18
200 0.2
201 0.23
202 0.28
203 0.34
204 0.37
205 0.45
206 0.5
207 0.5
208 0.53
209 0.53
210 0.45
211 0.43
212 0.39
213 0.3
214 0.24
215 0.18
216 0.13
217 0.1
218 0.09
219 0.04
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.08
226 0.09
227 0.09
228 0.12
229 0.14
230 0.15
231 0.16
232 0.17
233 0.22
234 0.21
235 0.21
236 0.22
237 0.24
238 0.24
239 0.26
240 0.28
241 0.21
242 0.21
243 0.21
244 0.18
245 0.15
246 0.14
247 0.12
248 0.09
249 0.08
250 0.07
251 0.07
252 0.04
253 0.04
254 0.04
255 0.04
256 0.06
257 0.07
258 0.06
259 0.07
260 0.07
261 0.08
262 0.08
263 0.08
264 0.07
265 0.06
266 0.08
267 0.07
268 0.08
269 0.1
270 0.12
271 0.13
272 0.15
273 0.2
274 0.23
275 0.31
276 0.36
277 0.44
278 0.53
279 0.64
280 0.72
281 0.76
282 0.81
283 0.8
284 0.81
285 0.82
286 0.81
287 0.74
288 0.67
289 0.62
290 0.56
291 0.5
292 0.43
293 0.32
294 0.22
295 0.17
296 0.13
297 0.09
298 0.06
299 0.05
300 0.04
301 0.04
302 0.04
303 0.04
304 0.04
305 0.04
306 0.05
307 0.05
308 0.06
309 0.07
310 0.07
311 0.08
312 0.1
313 0.12
314 0.19