Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9T5V6

Protein Details
Accession A0A0C9T5V6    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-31GWVEGERVRRKRARSRSRKAWGAWKVWHydrophilic
NLS Segment(s)
PositionSequence
11-39RVRRKRARSRSRKAWGAWKVWGARKTTRR
114-139PAHPSSRRVDANAARPRSRRLGARPR
202-203RR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MEVWGWVEGERVRRKRARSRSRKAWGAWKVWGARKTTRRTAPAPAPQPTPATTPTTGADACTPAPSEPVPALPITLERPASAPTPSASRSQTPQPPYPRPKPGPSVHAAVHARPAHPSSRRVDANAARPRSRRLGARPRDPHPPSPYSSTGHACSPGACAAAPTPKQRTPRPLPSSTGSARRPRASTMVRGARRCQSGGRQRRRKTATATQDGNGDAGRQRPGEEDAAGTGAAGPSAAGARARGERDGKRQADQRCDEGGELRDGSPVLVVPVPSSRLPPLLHACRPTASASVPSLSRSFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.68
3 0.77
4 0.79
5 0.8
6 0.86
7 0.87
8 0.91
9 0.9
10 0.85
11 0.84
12 0.81
13 0.75
14 0.69
15 0.65
16 0.62
17 0.61
18 0.6
19 0.55
20 0.56
21 0.6
22 0.63
23 0.65
24 0.66
25 0.65
26 0.65
27 0.68
28 0.68
29 0.69
30 0.68
31 0.63
32 0.58
33 0.54
34 0.53
35 0.46
36 0.4
37 0.33
38 0.31
39 0.28
40 0.26
41 0.25
42 0.25
43 0.23
44 0.2
45 0.19
46 0.15
47 0.15
48 0.14
49 0.15
50 0.11
51 0.13
52 0.13
53 0.13
54 0.12
55 0.13
56 0.13
57 0.12
58 0.12
59 0.1
60 0.12
61 0.12
62 0.14
63 0.13
64 0.12
65 0.13
66 0.15
67 0.16
68 0.15
69 0.14
70 0.12
71 0.15
72 0.16
73 0.19
74 0.2
75 0.21
76 0.24
77 0.3
78 0.36
79 0.38
80 0.44
81 0.49
82 0.56
83 0.62
84 0.67
85 0.69
86 0.68
87 0.67
88 0.68
89 0.64
90 0.6
91 0.55
92 0.51
93 0.41
94 0.44
95 0.39
96 0.31
97 0.35
98 0.3
99 0.27
100 0.24
101 0.26
102 0.23
103 0.26
104 0.3
105 0.26
106 0.31
107 0.32
108 0.32
109 0.37
110 0.35
111 0.42
112 0.45
113 0.46
114 0.43
115 0.43
116 0.45
117 0.44
118 0.42
119 0.38
120 0.4
121 0.46
122 0.5
123 0.59
124 0.61
125 0.59
126 0.66
127 0.65
128 0.61
129 0.56
130 0.52
131 0.44
132 0.44
133 0.44
134 0.35
135 0.35
136 0.31
137 0.26
138 0.23
139 0.22
140 0.16
141 0.14
142 0.13
143 0.11
144 0.09
145 0.07
146 0.07
147 0.07
148 0.12
149 0.14
150 0.17
151 0.21
152 0.25
153 0.31
154 0.34
155 0.43
156 0.46
157 0.54
158 0.57
159 0.56
160 0.55
161 0.52
162 0.54
163 0.48
164 0.48
165 0.42
166 0.42
167 0.43
168 0.43
169 0.41
170 0.38
171 0.42
172 0.37
173 0.37
174 0.39
175 0.44
176 0.46
177 0.47
178 0.48
179 0.47
180 0.46
181 0.42
182 0.37
183 0.37
184 0.42
185 0.51
186 0.59
187 0.63
188 0.67
189 0.75
190 0.78
191 0.74
192 0.71
193 0.7
194 0.69
195 0.67
196 0.64
197 0.55
198 0.51
199 0.46
200 0.39
201 0.29
202 0.2
203 0.13
204 0.13
205 0.15
206 0.13
207 0.13
208 0.14
209 0.17
210 0.18
211 0.17
212 0.15
213 0.13
214 0.14
215 0.13
216 0.11
217 0.08
218 0.06
219 0.05
220 0.04
221 0.04
222 0.03
223 0.04
224 0.05
225 0.04
226 0.05
227 0.08
228 0.12
229 0.14
230 0.18
231 0.24
232 0.29
233 0.37
234 0.47
235 0.47
236 0.5
237 0.55
238 0.58
239 0.61
240 0.59
241 0.55
242 0.49
243 0.47
244 0.42
245 0.39
246 0.35
247 0.28
248 0.26
249 0.22
250 0.2
251 0.19
252 0.18
253 0.14
254 0.12
255 0.1
256 0.1
257 0.1
258 0.1
259 0.12
260 0.15
261 0.16
262 0.18
263 0.18
264 0.21
265 0.22
266 0.27
267 0.34
268 0.39
269 0.44
270 0.45
271 0.45
272 0.43
273 0.44
274 0.4
275 0.34
276 0.28
277 0.27
278 0.25
279 0.26
280 0.25
281 0.26