Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9SQ92

Protein Details
Accession A0A0C9SQ92    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
115-141DSAGTTRTTKRRDRKGARPSEYLRKRCHydrophilic
NLS Segment(s)
PositionSequence
125-130RRDRKG
Subcellular Location(s) nucl 13, pero 7, mito_nucl 7
Family & Domain DBs
Amino Acid Sequences LFPCAPSAPSLAVDLQLLEFVQNLFVRMPPNTTAWCDTLEAFLGNRGYKLTTRDSIRRRFGNALQWYGCLVNQTRLAVDGALEKERETMLAKEKNSGRVSGAGTSMSLRRVLNNDSAGTTRTTKRRDRKGARPSEYLRKRCPLCFGGKQCHDEDAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.1
4 0.09
5 0.07
6 0.06
7 0.06
8 0.09
9 0.08
10 0.09
11 0.1
12 0.11
13 0.13
14 0.14
15 0.16
16 0.15
17 0.18
18 0.19
19 0.22
20 0.23
21 0.22
22 0.23
23 0.21
24 0.2
25 0.18
26 0.16
27 0.13
28 0.11
29 0.12
30 0.12
31 0.11
32 0.11
33 0.11
34 0.12
35 0.13
36 0.16
37 0.18
38 0.22
39 0.27
40 0.35
41 0.42
42 0.48
43 0.53
44 0.52
45 0.51
46 0.5
47 0.49
48 0.5
49 0.46
50 0.41
51 0.35
52 0.33
53 0.3
54 0.26
55 0.23
56 0.15
57 0.12
58 0.11
59 0.12
60 0.12
61 0.11
62 0.11
63 0.11
64 0.09
65 0.09
66 0.08
67 0.08
68 0.09
69 0.09
70 0.08
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.16
77 0.21
78 0.21
79 0.26
80 0.28
81 0.35
82 0.34
83 0.33
84 0.27
85 0.26
86 0.27
87 0.22
88 0.21
89 0.13
90 0.13
91 0.13
92 0.13
93 0.11
94 0.12
95 0.11
96 0.12
97 0.15
98 0.17
99 0.2
100 0.21
101 0.21
102 0.2
103 0.21
104 0.21
105 0.2
106 0.21
107 0.23
108 0.28
109 0.35
110 0.43
111 0.52
112 0.61
113 0.7
114 0.75
115 0.8
116 0.83
117 0.88
118 0.84
119 0.83
120 0.79
121 0.79
122 0.8
123 0.77
124 0.73
125 0.71
126 0.69
127 0.63
128 0.65
129 0.59
130 0.58
131 0.61
132 0.62
133 0.63
134 0.66
135 0.68
136 0.62