Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q10189

Protein Details
Accession Q10189    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-80AKLQAHKKKYYMKRKPPVMSLQNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007727  Spo12  
Gene Ontology GO:0005829  C:cytosol  
GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
KEGG spo:SPAC3F10.15c  -  
Pfam View protein in Pfam  
PF05032  Spo12  
Amino Acid Sequences MSETQADSIAKSSVETTIQPLHQESATLRQQVLQKHELPKHALNVASPTDSLMSPCTAKLQAHKKKYYMKRKPPVMSLQNTLQSVQTEKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.18
5 0.19
6 0.2
7 0.2
8 0.2
9 0.18
10 0.19
11 0.16
12 0.19
13 0.22
14 0.22
15 0.21
16 0.23
17 0.26
18 0.29
19 0.33
20 0.3
21 0.31
22 0.37
23 0.4
24 0.39
25 0.4
26 0.38
27 0.35
28 0.32
29 0.28
30 0.21
31 0.2
32 0.18
33 0.14
34 0.12
35 0.1
36 0.09
37 0.09
38 0.09
39 0.08
40 0.08
41 0.08
42 0.08
43 0.1
44 0.11
45 0.12
46 0.19
47 0.29
48 0.37
49 0.45
50 0.5
51 0.53
52 0.62
53 0.72
54 0.76
55 0.76
56 0.78
57 0.8
58 0.85
59 0.84
60 0.81
61 0.81
62 0.78
63 0.72
64 0.67
65 0.63
66 0.59
67 0.54
68 0.48
69 0.4
70 0.33