Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9SKB8

Protein Details
Accession A0A0C9SKB8    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MNARALKKRIRDRLRQRKFELERLHydrophilic
NLS Segment(s)
PositionSequence
7-17KKRIRDRLRQR
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MNARALKKRIRDRLRQRKFELERLEREYRNTVNEKNLRSHAKDRVKSREPGIVSLTRSYNALCEQLASLIRKGKALPGAVPPTPIDREGLFKLDVDDDIWQDIGLDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.85
4 0.85
5 0.82
6 0.8
7 0.78
8 0.74
9 0.7
10 0.68
11 0.69
12 0.59
13 0.56
14 0.53
15 0.44
16 0.43
17 0.41
18 0.36
19 0.39
20 0.43
21 0.42
22 0.41
23 0.45
24 0.44
25 0.45
26 0.47
27 0.48
28 0.52
29 0.55
30 0.57
31 0.6
32 0.6
33 0.58
34 0.55
35 0.5
36 0.42
37 0.38
38 0.35
39 0.29
40 0.25
41 0.24
42 0.22
43 0.17
44 0.16
45 0.14
46 0.12
47 0.1
48 0.1
49 0.08
50 0.08
51 0.08
52 0.09
53 0.12
54 0.12
55 0.13
56 0.17
57 0.17
58 0.18
59 0.18
60 0.19
61 0.21
62 0.21
63 0.21
64 0.23
65 0.27
66 0.27
67 0.28
68 0.25
69 0.25
70 0.26
71 0.24
72 0.19
73 0.16
74 0.2
75 0.21
76 0.23
77 0.2
78 0.18
79 0.19
80 0.18
81 0.18
82 0.15
83 0.14
84 0.12
85 0.13
86 0.13
87 0.11