Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9SV28

Protein Details
Accession A0A0C9SV28   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
93-112VLKAANKRGKRKAPANGKAAHydrophilic
NLS Segment(s)
PositionSequence
96-119AANKRGKRKAPANGKAAASKKKKS
Subcellular Location(s) mito 22.5, cyto_mito 13.333, cyto 3, cyto_nucl 2.833
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSRFVAQVYSPYSNLYTPLVVSPAGSTIPVASFLFLRAQNLVMSLDSICPNAAAMAVPAGVGLIMFMPTPLLVQTVALAYPHRKKICEVIAAVLKAANKRGKRKAPANGKAAASKKKKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.16
4 0.13
5 0.14
6 0.13
7 0.11
8 0.11
9 0.1
10 0.09
11 0.09
12 0.08
13 0.07
14 0.06
15 0.07
16 0.09
17 0.08
18 0.08
19 0.08
20 0.08
21 0.12
22 0.12
23 0.12
24 0.11
25 0.12
26 0.11
27 0.12
28 0.11
29 0.08
30 0.08
31 0.07
32 0.08
33 0.08
34 0.08
35 0.07
36 0.06
37 0.06
38 0.06
39 0.05
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.03
57 0.03
58 0.04
59 0.03
60 0.04
61 0.04
62 0.05
63 0.05
64 0.05
65 0.06
66 0.1
67 0.16
68 0.24
69 0.25
70 0.26
71 0.27
72 0.35
73 0.39
74 0.39
75 0.34
76 0.32
77 0.35
78 0.34
79 0.33
80 0.27
81 0.23
82 0.2
83 0.25
84 0.28
85 0.3
86 0.39
87 0.48
88 0.56
89 0.64
90 0.71
91 0.75
92 0.79
93 0.81
94 0.78
95 0.73
96 0.67
97 0.65
98 0.64
99 0.63