Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

O94238

Protein Details
Accession O94238    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
108-127FDRFAVMRLKKQRREQVNVAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 12, cyto 8.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR014722  Rib_L2_dom2  
IPR002784  Ribosomal_L14e_dom  
IPR039660  Ribosomal_protein_L14  
IPR041985  RPL14_KOW  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0022625  C:cytosolic large ribosomal subunit  
GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
GO:0042273  P:ribosomal large subunit biogenesis  
KEGG spo:SPAC1805.13  -  
Pfam View protein in Pfam  
PF00467  KOW  
PF01929  Ribosomal_L14e  
CDD cd06088  KOW_RPL14  
Amino Acid Sequences MEGFKRYVEVGRVVLVTKGEYTGKLAVIVDIVDHKRALIDSPCSEFPRQVIRYGSVVLTHIVMKLPRGARSGIVAKKWKAQDVCNKWASSAWAKKLEAKKVRSQLNDFDRFAVMRLKKQRREQVNVAVAKALKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.15
4 0.12
5 0.13
6 0.12
7 0.12
8 0.14
9 0.15
10 0.14
11 0.14
12 0.14
13 0.12
14 0.11
15 0.1
16 0.08
17 0.11
18 0.11
19 0.12
20 0.11
21 0.11
22 0.11
23 0.12
24 0.14
25 0.12
26 0.16
27 0.17
28 0.21
29 0.24
30 0.27
31 0.27
32 0.25
33 0.24
34 0.28
35 0.27
36 0.27
37 0.26
38 0.25
39 0.25
40 0.26
41 0.24
42 0.15
43 0.14
44 0.11
45 0.1
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.11
52 0.12
53 0.13
54 0.14
55 0.14
56 0.14
57 0.17
58 0.23
59 0.21
60 0.25
61 0.28
62 0.27
63 0.33
64 0.33
65 0.35
66 0.31
67 0.34
68 0.4
69 0.43
70 0.49
71 0.47
72 0.46
73 0.42
74 0.41
75 0.39
76 0.36
77 0.35
78 0.32
79 0.34
80 0.35
81 0.42
82 0.47
83 0.53
84 0.53
85 0.52
86 0.56
87 0.58
88 0.65
89 0.63
90 0.61
91 0.6
92 0.62
93 0.64
94 0.56
95 0.5
96 0.44
97 0.38
98 0.36
99 0.35
100 0.28
101 0.3
102 0.4
103 0.48
104 0.55
105 0.65
106 0.73
107 0.74
108 0.8
109 0.79
110 0.79
111 0.78
112 0.72
113 0.63
114 0.57