Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9SX07

Protein Details
Accession A0A0C9SX07    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MPKDSTKPKRKAAEKATKATRGTKAKKDPKAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
7-34KPKRKAAEKATKATRGTKAKKDPKAPKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKDSTKPKRKAAEKATKATRGTKAKKDPKAPKRALSAYMFFSQDWRERIKTENPDAGFGEVGKLLGAKWKELDDEEKKPYIEQAAQDKVRAEDEKSAYDSKPKAPASDEGDEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.81
4 0.78
5 0.73
6 0.69
7 0.67
8 0.65
9 0.65
10 0.65
11 0.68
12 0.71
13 0.77
14 0.81
15 0.83
16 0.83
17 0.86
18 0.82
19 0.77
20 0.75
21 0.7
22 0.64
23 0.58
24 0.5
25 0.42
26 0.39
27 0.34
28 0.26
29 0.24
30 0.22
31 0.22
32 0.21
33 0.21
34 0.2
35 0.2
36 0.24
37 0.3
38 0.34
39 0.34
40 0.37
41 0.33
42 0.34
43 0.33
44 0.3
45 0.22
46 0.16
47 0.12
48 0.07
49 0.06
50 0.05
51 0.04
52 0.03
53 0.08
54 0.08
55 0.08
56 0.09
57 0.1
58 0.11
59 0.12
60 0.2
61 0.21
62 0.26
63 0.29
64 0.3
65 0.3
66 0.29
67 0.29
68 0.25
69 0.22
70 0.21
71 0.25
72 0.31
73 0.32
74 0.33
75 0.33
76 0.31
77 0.32
78 0.3
79 0.25
80 0.24
81 0.26
82 0.27
83 0.3
84 0.32
85 0.28
86 0.34
87 0.34
88 0.32
89 0.38
90 0.36
91 0.35
92 0.35
93 0.41
94 0.41
95 0.44
96 0.41