Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9SPR2

Protein Details
Accession A0A0C9SPR2    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
62-108AGMRERGQRKRGRRGRGRRERGWRRRGRRERGWRRRGRRERNIASVDBasic
NLS Segment(s)
PositionSequence
65-102RERGQRKRGRRGRGRRERGWRRRGRRERGWRRRGRRER
Subcellular Location(s) mito 19, cyto 5, nucl 1, extr 1, pero 1
Family & Domain DBs
Amino Acid Sequences MAQAVRTGAAWTVQTSTSLTKGGRGCDDAHHADVHSVDRGGMEEDCVDGDRANVDGANVGGAGMRERGQRKRGRRGRGRRERGWRRRGRRERGWRRRGRRERNIASVDEGGADEGGVDVDSADGDCPDVECTDVHGADGNGAGRGCAERRAALPRKAPLWLREWRVWLQQHLPPALPHRSRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.16
4 0.15
5 0.18
6 0.17
7 0.21
8 0.23
9 0.25
10 0.26
11 0.27
12 0.26
13 0.27
14 0.33
15 0.31
16 0.3
17 0.27
18 0.24
19 0.23
20 0.23
21 0.21
22 0.15
23 0.12
24 0.1
25 0.1
26 0.1
27 0.11
28 0.1
29 0.09
30 0.07
31 0.07
32 0.08
33 0.08
34 0.08
35 0.06
36 0.06
37 0.06
38 0.07
39 0.07
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.07
52 0.11
53 0.16
54 0.21
55 0.29
56 0.36
57 0.44
58 0.55
59 0.61
60 0.67
61 0.74
62 0.8
63 0.83
64 0.87
65 0.87
66 0.85
67 0.88
68 0.89
69 0.88
70 0.88
71 0.86
72 0.84
73 0.87
74 0.89
75 0.87
76 0.86
77 0.87
78 0.88
79 0.89
80 0.91
81 0.89
82 0.88
83 0.91
84 0.91
85 0.9
86 0.89
87 0.88
88 0.83
89 0.81
90 0.74
91 0.64
92 0.56
93 0.45
94 0.35
95 0.25
96 0.19
97 0.11
98 0.08
99 0.06
100 0.04
101 0.03
102 0.03
103 0.03
104 0.02
105 0.02
106 0.02
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.05
115 0.05
116 0.06
117 0.06
118 0.09
119 0.11
120 0.11
121 0.11
122 0.11
123 0.11
124 0.11
125 0.12
126 0.09
127 0.08
128 0.08
129 0.08
130 0.07
131 0.09
132 0.09
133 0.12
134 0.13
135 0.13
136 0.16
137 0.26
138 0.33
139 0.38
140 0.43
141 0.45
142 0.45
143 0.49
144 0.51
145 0.45
146 0.44
147 0.45
148 0.46
149 0.46
150 0.49
151 0.48
152 0.51
153 0.51
154 0.5
155 0.49
156 0.45
157 0.47
158 0.44
159 0.42
160 0.37
161 0.4
162 0.44