Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9SK16

Protein Details
Accession A0A0C9SK16    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
71-100PGVARYPRKVTRRRSARKLAVRNKVKPFIKHydrophilic
NLS Segment(s)
PositionSequence
77-97PRKVTRRRSARKLAVRNKVKP
Subcellular Location(s) mito 16, cyto 7.5, cyto_nucl 5.5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038655  L27e_sf  
Amino Acid Sequences MTRFPAIALRRRGKHGRARACCEDCADGGAWFMGLPFGAESKCEALPLASPANDIPQIVDALAKVTKGLTPGVARYPRKVTRRRSARKLAVRNKVKPFIKPDFGSGRQWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.73
4 0.73
5 0.77
6 0.79
7 0.75
8 0.68
9 0.6
10 0.52
11 0.41
12 0.35
13 0.27
14 0.17
15 0.14
16 0.12
17 0.09
18 0.07
19 0.06
20 0.04
21 0.03
22 0.03
23 0.03
24 0.04
25 0.04
26 0.05
27 0.06
28 0.08
29 0.08
30 0.08
31 0.08
32 0.07
33 0.08
34 0.1
35 0.11
36 0.08
37 0.09
38 0.09
39 0.1
40 0.1
41 0.09
42 0.07
43 0.06
44 0.06
45 0.06
46 0.06
47 0.04
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.06
54 0.07
55 0.07
56 0.08
57 0.09
58 0.1
59 0.17
60 0.25
61 0.25
62 0.28
63 0.36
64 0.42
65 0.5
66 0.57
67 0.59
68 0.63
69 0.73
70 0.79
71 0.8
72 0.83
73 0.85
74 0.87
75 0.88
76 0.87
77 0.87
78 0.86
79 0.85
80 0.83
81 0.83
82 0.75
83 0.71
84 0.7
85 0.67
86 0.66
87 0.59
88 0.58
89 0.57
90 0.57