Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9UR27

Protein Details
Accession Q9UR27   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
14-42GLVHKVPWRLSQRRKYRHRQRLRAVDEVVHydrophilic
94-113RKGVHKSPKWTRSTNRVNPTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG spo:SPCC16A11.11  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGAFNSTLARFGGLVHKVPWRLSQRRKYRHRQRLRAVDEVVDVLRTALQEKNQSCKRIESFVANHQPESQMSPKDKYTMFTRKTQGAGLQGFRKGVHKSPKWTRSTNRVNPTGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.21
4 0.25
5 0.26
6 0.28
7 0.34
8 0.37
9 0.44
10 0.52
11 0.6
12 0.66
13 0.75
14 0.84
15 0.87
16 0.89
17 0.9
18 0.91
19 0.91
20 0.91
21 0.91
22 0.87
23 0.81
24 0.71
25 0.61
26 0.5
27 0.41
28 0.31
29 0.2
30 0.14
31 0.08
32 0.07
33 0.06
34 0.07
35 0.07
36 0.1
37 0.16
38 0.17
39 0.26
40 0.29
41 0.32
42 0.32
43 0.34
44 0.34
45 0.31
46 0.31
47 0.27
48 0.26
49 0.31
50 0.39
51 0.35
52 0.34
53 0.31
54 0.31
55 0.26
56 0.28
57 0.23
58 0.19
59 0.21
60 0.24
61 0.24
62 0.26
63 0.27
64 0.25
65 0.3
66 0.35
67 0.35
68 0.4
69 0.43
70 0.43
71 0.44
72 0.42
73 0.37
74 0.33
75 0.34
76 0.32
77 0.32
78 0.3
79 0.29
80 0.29
81 0.3
82 0.27
83 0.32
84 0.38
85 0.4
86 0.49
87 0.59
88 0.67
89 0.7
90 0.75
91 0.75
92 0.75
93 0.8
94 0.8
95 0.79