Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9P7U5

Protein Details
Accession Q9P7U5    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
114-136FSETNKSRYRRWQGHKRYSLALKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 14.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041698  Methyltransf_25  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0004395  F:hexaprenyldihydroxybenzoate methyltransferase activity  
GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
GO:0006744  P:ubiquinone biosynthetic process  
KEGG spo:SPAC977.03  -  
Pfam View protein in Pfam  
PF13649  Methyltransf_25  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MNLVQLGKLHENVLDAGCEPNRNARYLASLGYKVVGIDISERAISKAIDKTSSEKSNVNFNQRDFSRLNEFKGHFDTVIDIGCFHSILNSDHEPHTASLSHICHSDSSVFLRAFSETNKSRYRRWQGHKRYSLALKRNNVKKLSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.14
4 0.15
5 0.15
6 0.15
7 0.22
8 0.23
9 0.24
10 0.25
11 0.22
12 0.26
13 0.25
14 0.28
15 0.23
16 0.22
17 0.2
18 0.2
19 0.19
20 0.14
21 0.13
22 0.1
23 0.06
24 0.07
25 0.07
26 0.08
27 0.08
28 0.09
29 0.09
30 0.1
31 0.1
32 0.11
33 0.14
34 0.15
35 0.16
36 0.17
37 0.21
38 0.26
39 0.29
40 0.29
41 0.27
42 0.27
43 0.35
44 0.38
45 0.41
46 0.37
47 0.35
48 0.39
49 0.37
50 0.4
51 0.31
52 0.3
53 0.32
54 0.3
55 0.32
56 0.31
57 0.32
58 0.29
59 0.31
60 0.29
61 0.19
62 0.18
63 0.17
64 0.12
65 0.11
66 0.09
67 0.07
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.06
74 0.07
75 0.11
76 0.12
77 0.14
78 0.15
79 0.16
80 0.17
81 0.15
82 0.16
83 0.12
84 0.12
85 0.15
86 0.15
87 0.16
88 0.15
89 0.15
90 0.14
91 0.15
92 0.15
93 0.12
94 0.14
95 0.18
96 0.17
97 0.17
98 0.18
99 0.17
100 0.17
101 0.18
102 0.23
103 0.21
104 0.27
105 0.35
106 0.38
107 0.42
108 0.52
109 0.61
110 0.63
111 0.7
112 0.75
113 0.78
114 0.86
115 0.89
116 0.83
117 0.8
118 0.79
119 0.78
120 0.77
121 0.74
122 0.73
123 0.74
124 0.78
125 0.78