Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q9P7H0

Protein Details
Accession Q9P7H0    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
29-53AKPLAPKKLNKKMMKTVKKASKQKHHydrophilic
NLS Segment(s)
PositionSequence
30-68KPLAPKKLNKKMMKTVKKASKQKHILRGVKEVVKAVRKG
Subcellular Location(s) cyto 14, nucl 12.5, mito_nucl 7, cyto_pero 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002415  H/ACA_rnp_Nhp2-like  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
Gene Ontology GO:0031429  C:box H/ACA snoRNP complex  
GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0005732  C:sno(s)RNA-containing ribonucleoprotein complex  
GO:0034513  F:box H/ACA snoRNA binding  
GO:0019843  F:rRNA binding  
GO:0000469  P:cleavage involved in rRNA processing  
GO:0031118  P:rRNA pseudouridine synthesis  
GO:0031120  P:snRNA pseudouridine synthesis  
KEGG spo:SPAC1782.10c  -  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
Amino Acid Sequences MAKDKKDHKHSGSTEDEYDSYLPALMPIAKPLAPKKLNKKMMKTVKKASKQKHILRGVKEVVKAVRKGEKGLVILAGDISPMDVISHIPVLCEDNNVPYLYTVSKELLGEASNTKRPTSCVMIVPGGKKKDMSKVEEYKESYEEIIKEVPALEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.48
3 0.43
4 0.34
5 0.31
6 0.24
7 0.17
8 0.13
9 0.11
10 0.08
11 0.09
12 0.09
13 0.09
14 0.1
15 0.12
16 0.12
17 0.16
18 0.19
19 0.28
20 0.31
21 0.38
22 0.47
23 0.56
24 0.64
25 0.68
26 0.72
27 0.73
28 0.79
29 0.81
30 0.78
31 0.77
32 0.77
33 0.8
34 0.81
35 0.78
36 0.78
37 0.78
38 0.79
39 0.79
40 0.79
41 0.75
42 0.7
43 0.69
44 0.63
45 0.56
46 0.49
47 0.41
48 0.35
49 0.33
50 0.31
51 0.27
52 0.29
53 0.26
54 0.27
55 0.27
56 0.25
57 0.22
58 0.21
59 0.19
60 0.12
61 0.11
62 0.1
63 0.07
64 0.05
65 0.04
66 0.03
67 0.02
68 0.02
69 0.02
70 0.02
71 0.03
72 0.03
73 0.05
74 0.05
75 0.05
76 0.06
77 0.08
78 0.08
79 0.09
80 0.09
81 0.09
82 0.11
83 0.11
84 0.11
85 0.09
86 0.1
87 0.09
88 0.1
89 0.1
90 0.09
91 0.1
92 0.1
93 0.1
94 0.1
95 0.1
96 0.1
97 0.12
98 0.15
99 0.2
100 0.21
101 0.21
102 0.21
103 0.22
104 0.26
105 0.29
106 0.28
107 0.26
108 0.28
109 0.32
110 0.34
111 0.38
112 0.4
113 0.36
114 0.33
115 0.33
116 0.32
117 0.37
118 0.41
119 0.42
120 0.45
121 0.51
122 0.56
123 0.6
124 0.61
125 0.54
126 0.5
127 0.44
128 0.36
129 0.31
130 0.27
131 0.22
132 0.21
133 0.18
134 0.17