Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1ZZY6

Protein Details
Accession A0A0D1ZZY6   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
40-59SDEMKRKMLKLRKHHSQVRABasic
174-200EMPAASKKLKARQRRRSRSEQCARPGSHydrophilic
241-260VDRSRDPRLRGQRRGGREGLBasic
NLS Segment(s)
PositionSequence
179-191SKKLKARQRRRSR
Subcellular Location(s) mito 15, nucl 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MHVRMGYDRVSEQNIALILAQATSHVPFAIDALEVSRCRSDEMKRKMLKLRKHHSQVRAYILAQAHCKASTGSVHTACAPEALSEQSTEQLLDKLRSPWNRMTPAHRGHVHSQVDDIFYRPQPVAQRRQMHPALRRVVEVTKALERYNEYARKQIMQLEEGRQALQASGRAAEEMPAASKKLKARQRRRSRSEQCARPGSPLASSSSEYRVEPLAPSPVDGIHCLPLPTPTQSYLSGESVVDRSRDPRLRGQRRGGREGLDVVNTKAQCAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.16
4 0.14
5 0.1
6 0.09
7 0.09
8 0.07
9 0.08
10 0.08
11 0.09
12 0.07
13 0.08
14 0.07
15 0.08
16 0.08
17 0.07
18 0.06
19 0.08
20 0.12
21 0.12
22 0.14
23 0.15
24 0.15
25 0.18
26 0.22
27 0.29
28 0.36
29 0.44
30 0.53
31 0.55
32 0.61
33 0.68
34 0.72
35 0.72
36 0.73
37 0.73
38 0.73
39 0.78
40 0.8
41 0.8
42 0.8
43 0.76
44 0.72
45 0.66
46 0.56
47 0.52
48 0.46
49 0.4
50 0.34
51 0.29
52 0.23
53 0.2
54 0.2
55 0.15
56 0.15
57 0.15
58 0.17
59 0.21
60 0.2
61 0.21
62 0.21
63 0.22
64 0.2
65 0.18
66 0.14
67 0.09
68 0.09
69 0.1
70 0.09
71 0.09
72 0.09
73 0.1
74 0.09
75 0.09
76 0.09
77 0.1
78 0.11
79 0.11
80 0.13
81 0.16
82 0.22
83 0.25
84 0.29
85 0.33
86 0.39
87 0.44
88 0.44
89 0.46
90 0.48
91 0.49
92 0.51
93 0.48
94 0.45
95 0.42
96 0.48
97 0.44
98 0.35
99 0.32
100 0.26
101 0.25
102 0.21
103 0.19
104 0.13
105 0.12
106 0.13
107 0.12
108 0.14
109 0.19
110 0.25
111 0.32
112 0.37
113 0.44
114 0.44
115 0.52
116 0.54
117 0.53
118 0.52
119 0.51
120 0.48
121 0.41
122 0.4
123 0.34
124 0.31
125 0.27
126 0.22
127 0.17
128 0.15
129 0.16
130 0.16
131 0.15
132 0.15
133 0.16
134 0.23
135 0.26
136 0.24
137 0.27
138 0.28
139 0.29
140 0.28
141 0.29
142 0.23
143 0.2
144 0.22
145 0.21
146 0.23
147 0.22
148 0.22
149 0.18
150 0.16
151 0.14
152 0.12
153 0.11
154 0.08
155 0.08
156 0.08
157 0.08
158 0.08
159 0.08
160 0.08
161 0.07
162 0.08
163 0.08
164 0.09
165 0.09
166 0.13
167 0.17
168 0.25
169 0.33
170 0.42
171 0.53
172 0.63
173 0.74
174 0.81
175 0.85
176 0.88
177 0.89
178 0.89
179 0.88
180 0.85
181 0.81
182 0.79
183 0.71
184 0.64
185 0.58
186 0.48
187 0.39
188 0.32
189 0.28
190 0.22
191 0.23
192 0.21
193 0.22
194 0.22
195 0.2
196 0.21
197 0.19
198 0.17
199 0.16
200 0.16
201 0.18
202 0.16
203 0.17
204 0.16
205 0.16
206 0.17
207 0.17
208 0.17
209 0.14
210 0.15
211 0.14
212 0.14
213 0.15
214 0.17
215 0.18
216 0.19
217 0.19
218 0.21
219 0.22
220 0.25
221 0.26
222 0.25
223 0.23
224 0.21
225 0.2
226 0.2
227 0.2
228 0.18
229 0.16
230 0.17
231 0.26
232 0.32
233 0.35
234 0.43
235 0.52
236 0.61
237 0.69
238 0.77
239 0.77
240 0.78
241 0.81
242 0.74
243 0.66
244 0.59
245 0.55
246 0.47
247 0.43
248 0.37
249 0.31
250 0.35
251 0.31