Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1Z1U4

Protein Details
Accession A0A0D1Z1U4    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-43TKPANTPKASRKPAERLKVIHydrophilic
NLS Segment(s)
PositionSequence
32-37ASRKPA
200-248REKKAAKEKASKSGKGKQESKETKGEKANKKAAKGQGDLQEKPKKLTKA
514-549RNPPSGPAHMPRGGFRGGRGGRGGRGGARGGGKSAG
Subcellular Location(s) nucl 17.5, mito_nucl 11.5, mito 4.5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
IPR039722  Upf3  
IPR005120  UPF3_dom  
Gene Ontology GO:0003723  F:RNA binding  
GO:0000184  P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay  
Pfam View protein in Pfam  
PF00076  RRM_1  
PF03467  Smg4_UPF3  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12455  RRM_like_Smg4_UPF3  
cd00590  RRM_SF  
Amino Acid Sequences MAAPSQSVNGVLQVPAAILKKNDTKPANTPKASRKPAERLKVIIRRLPPGLTADEFGTIIGEEWKVGAGKVNWFQYKPGKVSKDFSKPSRPARAYLNVTDESHLIPLKDKVLQSNFIDAKNTTKDPALIGPPTLEYAPYTRVPLGKKRTDARQGTIDQDPEFIDFLQSLTNPVIKPTSLDADPAPKKEEITTTPLIEHLREKKAAKEKASKSGKGKQESKETKGEKANKKAAKGQGDLQEKPKKLTKAEKAAQQAVKVLNKEAASGTDKAATVQSAAKGASERKPERAARPISVAARIQQDLGLSPAVKRTKREVNTEAQAAGAAISGSQDAPATQSPKKGPKTPKSANTTEKSTSETADGSKSVPTSSAPPTVLKKPPQGAKAQAMAQPTAPKGPKAQKTAQPAQPPQSNSSPAASSSAAAATSAEPAALPRQAFLKHANPSQGITETLIADALSAFGAIEKVEIDRKKGFAYVDFADNEGMKKAIAASPVKVAQGAVQVLEKRDKSSSASGRNPPSGPAHMPRGGFRGGRGGRGGRGGARGGGKSAGGPASPSPSNATPAAPNAPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.14
4 0.14
5 0.14
6 0.2
7 0.29
8 0.33
9 0.42
10 0.42
11 0.46
12 0.54
13 0.64
14 0.68
15 0.64
16 0.68
17 0.69
18 0.76
19 0.78
20 0.75
21 0.73
22 0.73
23 0.79
24 0.81
25 0.74
26 0.7
27 0.73
28 0.74
29 0.72
30 0.67
31 0.61
32 0.57
33 0.55
34 0.5
35 0.42
36 0.37
37 0.35
38 0.3
39 0.28
40 0.23
41 0.22
42 0.2
43 0.18
44 0.15
45 0.1
46 0.09
47 0.09
48 0.08
49 0.07
50 0.07
51 0.09
52 0.08
53 0.09
54 0.13
55 0.13
56 0.2
57 0.25
58 0.33
59 0.35
60 0.35
61 0.4
62 0.43
63 0.48
64 0.47
65 0.51
66 0.5
67 0.5
68 0.56
69 0.6
70 0.62
71 0.62
72 0.63
73 0.65
74 0.66
75 0.71
76 0.75
77 0.69
78 0.62
79 0.62
80 0.65
81 0.6
82 0.56
83 0.53
84 0.45
85 0.44
86 0.42
87 0.35
88 0.27
89 0.23
90 0.2
91 0.15
92 0.14
93 0.15
94 0.16
95 0.2
96 0.2
97 0.25
98 0.28
99 0.32
100 0.32
101 0.39
102 0.39
103 0.35
104 0.37
105 0.3
106 0.31
107 0.31
108 0.31
109 0.23
110 0.22
111 0.22
112 0.21
113 0.25
114 0.24
115 0.2
116 0.19
117 0.18
118 0.18
119 0.18
120 0.16
121 0.13
122 0.1
123 0.11
124 0.14
125 0.15
126 0.16
127 0.17
128 0.21
129 0.25
130 0.33
131 0.39
132 0.42
133 0.47
134 0.5
135 0.57
136 0.63
137 0.63
138 0.58
139 0.57
140 0.53
141 0.51
142 0.49
143 0.42
144 0.33
145 0.29
146 0.25
147 0.19
148 0.17
149 0.13
150 0.1
151 0.08
152 0.08
153 0.08
154 0.07
155 0.08
156 0.08
157 0.11
158 0.11
159 0.12
160 0.13
161 0.12
162 0.13
163 0.13
164 0.16
165 0.14
166 0.15
167 0.15
168 0.23
169 0.26
170 0.26
171 0.27
172 0.23
173 0.24
174 0.24
175 0.27
176 0.21
177 0.25
178 0.25
179 0.23
180 0.23
181 0.25
182 0.24
183 0.22
184 0.24
185 0.24
186 0.25
187 0.29
188 0.29
189 0.34
190 0.43
191 0.48
192 0.49
193 0.53
194 0.53
195 0.59
196 0.65
197 0.63
198 0.59
199 0.62
200 0.63
201 0.61
202 0.64
203 0.59
204 0.63
205 0.63
206 0.62
207 0.63
208 0.57
209 0.55
210 0.56
211 0.61
212 0.58
213 0.6
214 0.65
215 0.59
216 0.59
217 0.6
218 0.58
219 0.54
220 0.48
221 0.45
222 0.45
223 0.47
224 0.46
225 0.47
226 0.48
227 0.43
228 0.44
229 0.44
230 0.38
231 0.37
232 0.45
233 0.45
234 0.48
235 0.51
236 0.55
237 0.54
238 0.58
239 0.54
240 0.45
241 0.41
242 0.34
243 0.32
244 0.27
245 0.23
246 0.19
247 0.18
248 0.18
249 0.15
250 0.14
251 0.14
252 0.14
253 0.14
254 0.13
255 0.13
256 0.13
257 0.13
258 0.11
259 0.09
260 0.09
261 0.09
262 0.08
263 0.08
264 0.08
265 0.09
266 0.11
267 0.15
268 0.22
269 0.23
270 0.25
271 0.32
272 0.34
273 0.37
274 0.43
275 0.41
276 0.34
277 0.36
278 0.36
279 0.31
280 0.3
281 0.26
282 0.2
283 0.2
284 0.19
285 0.16
286 0.13
287 0.12
288 0.1
289 0.11
290 0.09
291 0.07
292 0.07
293 0.12
294 0.16
295 0.18
296 0.19
297 0.24
298 0.32
299 0.36
300 0.43
301 0.41
302 0.43
303 0.44
304 0.44
305 0.38
306 0.29
307 0.25
308 0.18
309 0.14
310 0.07
311 0.04
312 0.03
313 0.03
314 0.03
315 0.03
316 0.03
317 0.03
318 0.03
319 0.05
320 0.08
321 0.11
322 0.12
323 0.17
324 0.21
325 0.3
326 0.34
327 0.4
328 0.48
329 0.53
330 0.62
331 0.65
332 0.7
333 0.68
334 0.71
335 0.71
336 0.65
337 0.61
338 0.53
339 0.47
340 0.42
341 0.35
342 0.29
343 0.23
344 0.2
345 0.16
346 0.15
347 0.14
348 0.11
349 0.12
350 0.11
351 0.1
352 0.1
353 0.1
354 0.12
355 0.14
356 0.17
357 0.17
358 0.2
359 0.24
360 0.3
361 0.35
362 0.36
363 0.39
364 0.41
365 0.46
366 0.47
367 0.47
368 0.46
369 0.44
370 0.43
371 0.41
372 0.37
373 0.33
374 0.3
375 0.27
376 0.24
377 0.21
378 0.23
379 0.21
380 0.19
381 0.24
382 0.33
383 0.38
384 0.43
385 0.49
386 0.5
387 0.58
388 0.65
389 0.65
390 0.65
391 0.62
392 0.61
393 0.6
394 0.56
395 0.51
396 0.47
397 0.44
398 0.37
399 0.35
400 0.29
401 0.24
402 0.24
403 0.2
404 0.16
405 0.13
406 0.12
407 0.1
408 0.09
409 0.09
410 0.07
411 0.07
412 0.07
413 0.06
414 0.06
415 0.07
416 0.09
417 0.11
418 0.1
419 0.1
420 0.13
421 0.14
422 0.17
423 0.21
424 0.26
425 0.29
426 0.32
427 0.36
428 0.34
429 0.34
430 0.34
431 0.3
432 0.24
433 0.2
434 0.18
435 0.15
436 0.13
437 0.12
438 0.1
439 0.08
440 0.07
441 0.06
442 0.04
443 0.04
444 0.03
445 0.04
446 0.04
447 0.04
448 0.04
449 0.04
450 0.06
451 0.13
452 0.15
453 0.19
454 0.22
455 0.23
456 0.24
457 0.27
458 0.27
459 0.23
460 0.27
461 0.25
462 0.27
463 0.26
464 0.25
465 0.23
466 0.23
467 0.21
468 0.16
469 0.14
470 0.09
471 0.09
472 0.1
473 0.11
474 0.16
475 0.17
476 0.18
477 0.23
478 0.25
479 0.25
480 0.23
481 0.21
482 0.18
483 0.2
484 0.19
485 0.15
486 0.17
487 0.19
488 0.22
489 0.28
490 0.27
491 0.25
492 0.27
493 0.28
494 0.29
495 0.37
496 0.42
497 0.45
498 0.52
499 0.58
500 0.62
501 0.66
502 0.61
503 0.55
504 0.51
505 0.47
506 0.44
507 0.42
508 0.43
509 0.42
510 0.43
511 0.42
512 0.41
513 0.4
514 0.35
515 0.31
516 0.34
517 0.31
518 0.34
519 0.36
520 0.34
521 0.33
522 0.35
523 0.36
524 0.29
525 0.3
526 0.28
527 0.27
528 0.29
529 0.27
530 0.25
531 0.24
532 0.21
533 0.19
534 0.21
535 0.18
536 0.14
537 0.16
538 0.16
539 0.21
540 0.21
541 0.22
542 0.24
543 0.24
544 0.28
545 0.27
546 0.28
547 0.25
548 0.28