Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1XR13

Protein Details
Accession A0A0D1XR13    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
317-342GDTQKSGSNKRARKTKKRADGGLGLPHydrophilic
NLS Segment(s)
PositionSequence
325-334NKRARKTKKR
Subcellular Location(s) extr 10, cyto 6, nucl 5, mito 5, mito_nucl 5
Family & Domain DBs
Amino Acid Sequences MHKKLFTFALIGLGAASKVPVVEDADIPNLRNAEGALGLAKRQGPLGGVGLPGLQALQSVANGLPLPVKKRQLPDHVPLVNNDELPDLKNTEGALGIDTARVVPSKIPLVDNKDLPDLGNAEKAVGLDKRQFRGAKLPLLNTDELPDLDPTLKAFGLEGSSRRSRRRRQLSSADFPLVNEQDLPNLDNTENALGLGKQNKRQLPKIPLIDESALPDLSGTEAAFGIKDDRRVKKRGLALPSIGDNSALDGVKRLAGALEGAASDATSQGTGGATGSAGIAGLKKTKRDGLGLPLLDKAQLPDLKKAESALGILDNTGDTQKSGSNKRARKTKKRADGGLGLPLLDNLALPNLNKTESRLGIHLPFRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.09
4 0.05
5 0.05
6 0.05
7 0.07
8 0.09
9 0.11
10 0.12
11 0.14
12 0.2
13 0.21
14 0.22
15 0.23
16 0.21
17 0.19
18 0.18
19 0.16
20 0.12
21 0.11
22 0.1
23 0.1
24 0.1
25 0.11
26 0.13
27 0.14
28 0.13
29 0.14
30 0.14
31 0.12
32 0.13
33 0.15
34 0.14
35 0.12
36 0.12
37 0.12
38 0.11
39 0.1
40 0.08
41 0.05
42 0.04
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.08
49 0.08
50 0.08
51 0.12
52 0.14
53 0.19
54 0.23
55 0.29
56 0.33
57 0.4
58 0.48
59 0.53
60 0.57
61 0.59
62 0.62
63 0.62
64 0.58
65 0.52
66 0.5
67 0.41
68 0.34
69 0.29
70 0.21
71 0.17
72 0.17
73 0.18
74 0.14
75 0.12
76 0.13
77 0.13
78 0.12
79 0.12
80 0.1
81 0.09
82 0.08
83 0.08
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.07
91 0.09
92 0.12
93 0.14
94 0.16
95 0.19
96 0.27
97 0.3
98 0.31
99 0.3
100 0.29
101 0.27
102 0.25
103 0.23
104 0.17
105 0.14
106 0.15
107 0.13
108 0.11
109 0.12
110 0.11
111 0.12
112 0.11
113 0.12
114 0.17
115 0.21
116 0.22
117 0.28
118 0.29
119 0.28
120 0.36
121 0.37
122 0.38
123 0.37
124 0.37
125 0.35
126 0.37
127 0.36
128 0.28
129 0.25
130 0.18
131 0.16
132 0.15
133 0.12
134 0.09
135 0.09
136 0.09
137 0.08
138 0.08
139 0.08
140 0.06
141 0.06
142 0.06
143 0.07
144 0.09
145 0.1
146 0.13
147 0.2
148 0.23
149 0.31
150 0.39
151 0.46
152 0.55
153 0.65
154 0.67
155 0.7
156 0.77
157 0.77
158 0.76
159 0.7
160 0.61
161 0.5
162 0.43
163 0.37
164 0.27
165 0.19
166 0.13
167 0.1
168 0.09
169 0.09
170 0.1
171 0.07
172 0.08
173 0.08
174 0.07
175 0.08
176 0.07
177 0.06
178 0.06
179 0.06
180 0.05
181 0.07
182 0.13
183 0.15
184 0.19
185 0.25
186 0.29
187 0.33
188 0.37
189 0.43
190 0.43
191 0.48
192 0.48
193 0.44
194 0.42
195 0.4
196 0.37
197 0.29
198 0.25
199 0.19
200 0.14
201 0.12
202 0.1
203 0.08
204 0.07
205 0.07
206 0.05
207 0.04
208 0.04
209 0.04
210 0.05
211 0.05
212 0.08
213 0.09
214 0.16
215 0.22
216 0.3
217 0.35
218 0.39
219 0.42
220 0.45
221 0.52
222 0.52
223 0.51
224 0.47
225 0.44
226 0.42
227 0.41
228 0.36
229 0.27
230 0.2
231 0.15
232 0.12
233 0.12
234 0.1
235 0.08
236 0.08
237 0.09
238 0.09
239 0.09
240 0.08
241 0.06
242 0.06
243 0.06
244 0.05
245 0.05
246 0.04
247 0.05
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.04
259 0.04
260 0.04
261 0.04
262 0.04
263 0.04
264 0.04
265 0.04
266 0.05
267 0.06
268 0.12
269 0.13
270 0.16
271 0.19
272 0.23
273 0.25
274 0.28
275 0.3
276 0.32
277 0.39
278 0.38
279 0.36
280 0.33
281 0.31
282 0.28
283 0.25
284 0.18
285 0.17
286 0.2
287 0.21
288 0.27
289 0.29
290 0.3
291 0.3
292 0.3
293 0.25
294 0.22
295 0.2
296 0.14
297 0.13
298 0.12
299 0.11
300 0.1
301 0.09
302 0.09
303 0.1
304 0.08
305 0.07
306 0.08
307 0.12
308 0.18
309 0.24
310 0.33
311 0.42
312 0.48
313 0.57
314 0.66
315 0.74
316 0.78
317 0.83
318 0.85
319 0.86
320 0.89
321 0.87
322 0.84
323 0.81
324 0.73
325 0.69
326 0.58
327 0.48
328 0.38
329 0.31
330 0.24
331 0.16
332 0.13
333 0.05
334 0.07
335 0.09
336 0.09
337 0.13
338 0.15
339 0.17
340 0.18
341 0.22
342 0.27
343 0.29
344 0.32
345 0.3
346 0.33
347 0.38