Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1YIV1

Protein Details
Accession A0A0D1YIV1   
Localization Confidence Low
Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-26PSLLRQLKCARAPQRRHFAAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto_nucl 3, nucl 2.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR000073  AB_hydrolase_1  
Pfam View protein in Pfam  
PF00561  Abhydrolase_1  
Amino Acid Sequences MATPRLPSLLRQLKCARAPQRRHFAASREVVDLAYDLHEPPKDVPRNNPIVFIHGFFGSKKNNRSMSKVLAKELGRPVYALDLRNHGDSPHHPVHDYRILAADISNFLSKHKIKDPTLIGHSMGAKAAMCVALQSPSSVKNLIPVDNAPVDANFKSDFALYLQGMRDVAKARPKRQSEADEILKPYAKELSVRQFLLTNLIRSPSNKEELVWRVPIDILAKSLDAMMDFPYTNPDEIRYEGPTLFIRGTRSHYVADETLPVIGRFFPRFELQDIEAGHWVISEKPEEFRRAVVSWLQDKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.63
4 0.64
5 0.73
6 0.75
7 0.8
8 0.76
9 0.77
10 0.72
11 0.67
12 0.66
13 0.63
14 0.55
15 0.47
16 0.43
17 0.36
18 0.32
19 0.26
20 0.18
21 0.13
22 0.11
23 0.09
24 0.12
25 0.13
26 0.14
27 0.17
28 0.26
29 0.31
30 0.33
31 0.4
32 0.46
33 0.55
34 0.54
35 0.56
36 0.46
37 0.45
38 0.43
39 0.37
40 0.3
41 0.22
42 0.22
43 0.17
44 0.22
45 0.25
46 0.3
47 0.33
48 0.39
49 0.47
50 0.49
51 0.55
52 0.56
53 0.56
54 0.59
55 0.57
56 0.51
57 0.49
58 0.47
59 0.46
60 0.47
61 0.4
62 0.31
63 0.29
64 0.27
65 0.27
66 0.29
67 0.26
68 0.21
69 0.23
70 0.24
71 0.26
72 0.26
73 0.2
74 0.2
75 0.19
76 0.26
77 0.27
78 0.26
79 0.25
80 0.25
81 0.31
82 0.34
83 0.32
84 0.24
85 0.21
86 0.21
87 0.2
88 0.19
89 0.14
90 0.09
91 0.1
92 0.11
93 0.09
94 0.09
95 0.16
96 0.17
97 0.2
98 0.26
99 0.31
100 0.31
101 0.38
102 0.41
103 0.4
104 0.42
105 0.39
106 0.33
107 0.27
108 0.27
109 0.2
110 0.16
111 0.11
112 0.08
113 0.07
114 0.07
115 0.05
116 0.04
117 0.04
118 0.05
119 0.05
120 0.06
121 0.06
122 0.06
123 0.08
124 0.09
125 0.1
126 0.09
127 0.13
128 0.15
129 0.15
130 0.15
131 0.14
132 0.15
133 0.15
134 0.15
135 0.1
136 0.09
137 0.1
138 0.09
139 0.1
140 0.08
141 0.08
142 0.08
143 0.08
144 0.08
145 0.07
146 0.09
147 0.08
148 0.09
149 0.09
150 0.09
151 0.09
152 0.09
153 0.1
154 0.1
155 0.12
156 0.19
157 0.24
158 0.29
159 0.38
160 0.4
161 0.43
162 0.47
163 0.49
164 0.48
165 0.5
166 0.49
167 0.44
168 0.42
169 0.4
170 0.35
171 0.3
172 0.24
173 0.19
174 0.14
175 0.13
176 0.15
177 0.22
178 0.24
179 0.25
180 0.25
181 0.24
182 0.24
183 0.29
184 0.27
185 0.2
186 0.17
187 0.18
188 0.19
189 0.19
190 0.25
191 0.21
192 0.24
193 0.23
194 0.22
195 0.27
196 0.31
197 0.33
198 0.29
199 0.25
200 0.22
201 0.22
202 0.23
203 0.18
204 0.14
205 0.12
206 0.1
207 0.1
208 0.1
209 0.1
210 0.08
211 0.07
212 0.07
213 0.07
214 0.08
215 0.08
216 0.08
217 0.12
218 0.13
219 0.14
220 0.13
221 0.14
222 0.15
223 0.17
224 0.2
225 0.19
226 0.2
227 0.19
228 0.21
229 0.2
230 0.2
231 0.19
232 0.18
233 0.19
234 0.19
235 0.25
236 0.27
237 0.28
238 0.28
239 0.28
240 0.3
241 0.28
242 0.26
243 0.22
244 0.18
245 0.17
246 0.17
247 0.15
248 0.12
249 0.13
250 0.16
251 0.16
252 0.17
253 0.18
254 0.22
255 0.24
256 0.26
257 0.29
258 0.27
259 0.3
260 0.3
261 0.29
262 0.26
263 0.24
264 0.21
265 0.17
266 0.16
267 0.13
268 0.14
269 0.15
270 0.14
271 0.2
272 0.25
273 0.29
274 0.29
275 0.31
276 0.33
277 0.31
278 0.33
279 0.32
280 0.35