Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9UUB5

Protein Details
Accession Q9UUB5   
Localization Confidence High
Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-33FVFVRKGKEKAGSKRRKSSVEDDHydrophilic
48-70SDTPIVKRNKELRKGKGRRSSLDHydrophilic
NLS Segment(s)
PositionSequence
15-27RKGKEKAGSKRRK
54-74KRNKELRKGKGRRSSLDQRGK
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013218  Dsn1/Mis13  
Gene Ontology GO:0000779  C:condensed chromosome, centromeric region  
GO:0000939  C:inner kinetochore  
GO:0000776  C:kinetochore  
GO:0000444  C:MIS12/MIND type complex  
GO:0005634  C:nucleus  
GO:0051301  P:cell division  
GO:0000070  P:mitotic sister chromatid segregation  
GO:0051455  P:monopolar spindle attachment to meiosis I kinetochore  
KEGG spo:SPBC409.09c  -  
Pfam View protein in Pfam  
PF08202  MIS13  
Amino Acid Sequences MKRKPEEQEGFVFVRKGKEKAGSKRRKSSVEDDPDTSQTDGLVELPVSDTPIVKRNKELRKGKGRRSSLDQRGKRASSIGTGFEALPHADVPSHEYYRHISKDLSEPLRIKQLLLWASSKALEEQRKKYGETEEASEAAIARSIVQEVLNELLANKVSVSWYQRPPDAVIPNKPHPQNLKNAQLVDELSAKLTQLHNEEAAWRAVAANSVSSDKSILSFKKAVESIDSKQDLDKQDSPLPPDDAPELPNISKLKPKFHTLLDMLAENIHTLHSLTNAGPEVRSSYGRLAAQDFIAHRKSLLSFSKYVDTMNLLRLLSEASYKSSSNESV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.36
4 0.35
5 0.41
6 0.48
7 0.57
8 0.66
9 0.69
10 0.74
11 0.82
12 0.85
13 0.83
14 0.8
15 0.77
16 0.76
17 0.76
18 0.71
19 0.64
20 0.61
21 0.55
22 0.51
23 0.43
24 0.33
25 0.22
26 0.18
27 0.14
28 0.11
29 0.1
30 0.07
31 0.07
32 0.08
33 0.08
34 0.09
35 0.09
36 0.1
37 0.11
38 0.19
39 0.23
40 0.24
41 0.32
42 0.4
43 0.5
44 0.59
45 0.66
46 0.69
47 0.75
48 0.83
49 0.85
50 0.85
51 0.82
52 0.77
53 0.77
54 0.78
55 0.77
56 0.78
57 0.73
58 0.71
59 0.72
60 0.68
61 0.6
62 0.51
63 0.42
64 0.36
65 0.33
66 0.27
67 0.21
68 0.21
69 0.19
70 0.18
71 0.17
72 0.12
73 0.1
74 0.09
75 0.08
76 0.07
77 0.07
78 0.12
79 0.16
80 0.17
81 0.17
82 0.18
83 0.21
84 0.27
85 0.29
86 0.26
87 0.21
88 0.22
89 0.29
90 0.35
91 0.35
92 0.33
93 0.33
94 0.33
95 0.4
96 0.37
97 0.31
98 0.24
99 0.27
100 0.25
101 0.25
102 0.25
103 0.17
104 0.18
105 0.19
106 0.18
107 0.14
108 0.18
109 0.24
110 0.29
111 0.33
112 0.39
113 0.4
114 0.41
115 0.41
116 0.39
117 0.37
118 0.32
119 0.31
120 0.25
121 0.24
122 0.23
123 0.2
124 0.16
125 0.11
126 0.1
127 0.06
128 0.05
129 0.04
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.06
136 0.06
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.04
143 0.04
144 0.04
145 0.06
146 0.11
147 0.16
148 0.2
149 0.21
150 0.22
151 0.23
152 0.25
153 0.28
154 0.29
155 0.27
156 0.29
157 0.33
158 0.38
159 0.42
160 0.41
161 0.4
162 0.4
163 0.4
164 0.42
165 0.43
166 0.46
167 0.42
168 0.42
169 0.39
170 0.35
171 0.32
172 0.25
173 0.2
174 0.12
175 0.11
176 0.1
177 0.09
178 0.1
179 0.1
180 0.11
181 0.12
182 0.13
183 0.12
184 0.12
185 0.13
186 0.13
187 0.13
188 0.1
189 0.08
190 0.07
191 0.07
192 0.08
193 0.07
194 0.06
195 0.07
196 0.08
197 0.09
198 0.09
199 0.09
200 0.08
201 0.09
202 0.13
203 0.13
204 0.16
205 0.18
206 0.18
207 0.23
208 0.24
209 0.23
210 0.23
211 0.27
212 0.25
213 0.3
214 0.31
215 0.26
216 0.27
217 0.32
218 0.3
219 0.32
220 0.33
221 0.3
222 0.35
223 0.37
224 0.39
225 0.37
226 0.37
227 0.3
228 0.28
229 0.26
230 0.21
231 0.2
232 0.19
233 0.18
234 0.16
235 0.21
236 0.21
237 0.2
238 0.26
239 0.27
240 0.34
241 0.34
242 0.4
243 0.39
244 0.39
245 0.45
246 0.4
247 0.42
248 0.35
249 0.32
250 0.27
251 0.23
252 0.21
253 0.13
254 0.12
255 0.07
256 0.06
257 0.06
258 0.06
259 0.07
260 0.09
261 0.09
262 0.12
263 0.13
264 0.14
265 0.13
266 0.13
267 0.15
268 0.16
269 0.18
270 0.17
271 0.18
272 0.23
273 0.24
274 0.25
275 0.24
276 0.23
277 0.22
278 0.23
279 0.22
280 0.23
281 0.24
282 0.23
283 0.2
284 0.21
285 0.22
286 0.26
287 0.32
288 0.31
289 0.31
290 0.35
291 0.4
292 0.38
293 0.37
294 0.31
295 0.29
296 0.26
297 0.27
298 0.27
299 0.22
300 0.21
301 0.21
302 0.2
303 0.17
304 0.18
305 0.16
306 0.16
307 0.19
308 0.2
309 0.21