Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1Z8W5

Protein Details
Accession A0A0D1Z8W5    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-33GAVKKSSNPNAVKKNKRPTTQKPQRGARVIHydrophilic
71-91LLGGGKKDKKEQQKTAQSGKKHydrophilic
NLS Segment(s)
PositionSequence
13-49NAVKKNKRPTTQKPQRGARVIAPKKAKLIAKQKLLKK
76-81KKDKKE
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGAVKKSSNPNAVKKNKRPTTQKPQRGARVIAPKKAKLIAKQKLLKKHTAGLTALTEKNLAEKAGHLELLGGGKKDKKEQQKTAQSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.79
4 0.82
5 0.82
6 0.84
7 0.84
8 0.84
9 0.85
10 0.85
11 0.85
12 0.83
13 0.83
14 0.83
15 0.78
16 0.71
17 0.66
18 0.67
19 0.61
20 0.58
21 0.54
22 0.47
23 0.44
24 0.46
25 0.41
26 0.38
27 0.45
28 0.45
29 0.49
30 0.55
31 0.57
32 0.62
33 0.62
34 0.59
35 0.51
36 0.49
37 0.43
38 0.39
39 0.35
40 0.28
41 0.27
42 0.26
43 0.24
44 0.19
45 0.16
46 0.13
47 0.15
48 0.13
49 0.11
50 0.08
51 0.09
52 0.12
53 0.13
54 0.13
55 0.11
56 0.11
57 0.11
58 0.14
59 0.15
60 0.11
61 0.13
62 0.17
63 0.19
64 0.26
65 0.34
66 0.42
67 0.51
68 0.6
69 0.68
70 0.75
71 0.81