Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P0CT63

Protein Details
Accession P0CT63    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
17-39QTPKVEKQEKPKQPKGRAYKRLLHydrophilic
NLS Segment(s)
PositionSequence
14-36VKSQTPKVEKQEKPKQPKGRAYK
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:0005829  C:cytosol  
GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
GO:0042254  P:ribosome biogenesis  
KEGG spo:SPAC19B12.04  -  
spo:SPBC19G7.03c  -  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKPKQPKGRAYKRLLYVRRFVNVTNMVGGKRRMNPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.49
5 0.53
6 0.61
7 0.65
8 0.7
9 0.69
10 0.71
11 0.74
12 0.75
13 0.78
14 0.78
15 0.79
16 0.77
17 0.81
18 0.81
19 0.81
20 0.81
21 0.78
22 0.75
23 0.74
24 0.75
25 0.72
26 0.66
27 0.62
28 0.55
29 0.53
30 0.47
31 0.4
32 0.38
33 0.35
34 0.32
35 0.29
36 0.27
37 0.25
38 0.27
39 0.3
40 0.28
41 0.32