Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1XQX8

Protein Details
Accession A0A0D1XQX8    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 12, nucl 8.5, mito_nucl 7, cyto_pero 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKANHAVVLDKTTSDKLQKDVQSYRLITVAVLVDRLKINGSLARAALKDLEEKGQIKKVVSHSKMQVYTRAVGGAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.88
9 0.85
10 0.83
11 0.74
12 0.66
13 0.55
14 0.51
15 0.41
16 0.36
17 0.29
18 0.2
19 0.18
20 0.17
21 0.18
22 0.16
23 0.17
24 0.17
25 0.24
26 0.26
27 0.3
28 0.31
29 0.33
30 0.35
31 0.34
32 0.31
33 0.25
34 0.23
35 0.17
36 0.15
37 0.12
38 0.07
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.09
48 0.1
49 0.1
50 0.1
51 0.12
52 0.12
53 0.12
54 0.12
55 0.11
56 0.12
57 0.12
58 0.14
59 0.16
60 0.18
61 0.2
62 0.25
63 0.27
64 0.25
65 0.3
66 0.36
67 0.43
68 0.44
69 0.48
70 0.48
71 0.54
72 0.58
73 0.55
74 0.53
75 0.46
76 0.45
77 0.4