Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

O59678

Protein Details
Accession O59678    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
141-166EGEKEKKLTSKQVRNTSKKIKRSRRHBasic
NLS Segment(s)
PositionSequence
80-109RAKPLPKPKPETKWQRFARIKGIAPKKREG
146-166KKLTSKQVRNTSKKIKRSRRH
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0042273  P:ribosomal large subunit biogenesis  
GO:0006364  P:rRNA processing  
KEGG spo:SPBC29A3.16  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSAQIENSIPLDFDLGNMAAFDISPLDETKLSGSEKESFLFSLSRDNVQQLVNKMISLPKERTSDGVLLQLPETVTPLPRAKPLPKPKPETKWQRFARIKGIAPKKREGRLVFDEASGEWVPKWGYKGKNKELETQWLVEEGEKEKKLTSKQVRNTSKKIKRSRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.09
6 0.07
7 0.07
8 0.07
9 0.05
10 0.05
11 0.06
12 0.07
13 0.09
14 0.09
15 0.1
16 0.11
17 0.13
18 0.14
19 0.14
20 0.16
21 0.18
22 0.19
23 0.2
24 0.19
25 0.17
26 0.17
27 0.17
28 0.14
29 0.18
30 0.18
31 0.19
32 0.19
33 0.2
34 0.2
35 0.21
36 0.24
37 0.19
38 0.22
39 0.2
40 0.19
41 0.18
42 0.18
43 0.2
44 0.21
45 0.22
46 0.23
47 0.25
48 0.26
49 0.27
50 0.27
51 0.25
52 0.21
53 0.22
54 0.17
55 0.15
56 0.15
57 0.14
58 0.11
59 0.09
60 0.1
61 0.06
62 0.07
63 0.09
64 0.11
65 0.11
66 0.14
67 0.18
68 0.21
69 0.3
70 0.4
71 0.47
72 0.52
73 0.59
74 0.63
75 0.67
76 0.73
77 0.74
78 0.7
79 0.71
80 0.67
81 0.7
82 0.68
83 0.64
84 0.62
85 0.57
86 0.54
87 0.52
88 0.59
89 0.54
90 0.53
91 0.58
92 0.56
93 0.55
94 0.59
95 0.51
96 0.48
97 0.48
98 0.5
99 0.43
100 0.37
101 0.34
102 0.27
103 0.29
104 0.21
105 0.15
106 0.1
107 0.11
108 0.11
109 0.12
110 0.15
111 0.17
112 0.25
113 0.34
114 0.44
115 0.52
116 0.6
117 0.62
118 0.67
119 0.64
120 0.65
121 0.59
122 0.51
123 0.42
124 0.35
125 0.32
126 0.25
127 0.24
128 0.18
129 0.23
130 0.23
131 0.23
132 0.24
133 0.29
134 0.32
135 0.41
136 0.48
137 0.5
138 0.59
139 0.69
140 0.78
141 0.81
142 0.86
143 0.87
144 0.85
145 0.86
146 0.87