Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1ZUZ2

Protein Details
Accession A0A0D1ZUZ2    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-26QNSSSNRQWRSKRWNTPAVLHydrophilic
120-153DPGRLHHRSATKRPHPTPRTIKTRSQRISRAPVRHydrophilic
NLS Segment(s)
PositionSequence
70-83PKRREIKPRRAKEK
130-141TKRPHPTPRTIK
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences EKGSGDQNSSSNRQWRSKRWNTPAVLGKARVSKSTPKGRNIRTRTFKAAVSKPISVDSAVTIPSGTGQMPKRREIKPRRAKEKALGQLLTQRVAKANRFADTGTKSRSRAQCSCDGPIRDPGRLHHRSATKRPHPTPRTIKTRSQRISRAPVRWAPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.62
3 0.67
4 0.73
5 0.78
6 0.8
7 0.82
8 0.76
9 0.77
10 0.76
11 0.72
12 0.65
13 0.57
14 0.51
15 0.49
16 0.47
17 0.41
18 0.36
19 0.38
20 0.42
21 0.51
22 0.54
23 0.56
24 0.64
25 0.7
26 0.77
27 0.76
28 0.77
29 0.75
30 0.74
31 0.73
32 0.66
33 0.61
34 0.58
35 0.55
36 0.52
37 0.48
38 0.43
39 0.37
40 0.36
41 0.33
42 0.25
43 0.2
44 0.14
45 0.1
46 0.09
47 0.08
48 0.07
49 0.06
50 0.06
51 0.06
52 0.06
53 0.1
54 0.14
55 0.2
56 0.23
57 0.28
58 0.34
59 0.37
60 0.48
61 0.52
62 0.6
63 0.64
64 0.71
65 0.75
66 0.74
67 0.73
68 0.69
69 0.69
70 0.64
71 0.58
72 0.49
73 0.4
74 0.41
75 0.39
76 0.34
77 0.25
78 0.19
79 0.18
80 0.2
81 0.21
82 0.22
83 0.23
84 0.22
85 0.22
86 0.22
87 0.24
88 0.26
89 0.28
90 0.27
91 0.28
92 0.29
93 0.35
94 0.41
95 0.43
96 0.43
97 0.44
98 0.48
99 0.48
100 0.52
101 0.51
102 0.48
103 0.43
104 0.48
105 0.45
106 0.4
107 0.37
108 0.37
109 0.4
110 0.42
111 0.42
112 0.4
113 0.46
114 0.51
115 0.6
116 0.66
117 0.65
118 0.72
119 0.76
120 0.8
121 0.77
122 0.79
123 0.8
124 0.79
125 0.8
126 0.75
127 0.78
128 0.77
129 0.82
130 0.8
131 0.78
132 0.77
133 0.76
134 0.81
135 0.79
136 0.75
137 0.71