Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q9UTI4

Protein Details
Accession Q9UTI4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-39LEYKLIKKNKNPKISNSKKKNSTRPALQDKTHydrophilic
NLS Segment(s)
PositionSequence
15-28KKNKNPKISNSKKK
Subcellular Location(s) nucl 12.5, cyto_nucl 11.5, cyto 9.5, mito 4
Family & Domain DBs
Gene Ontology GO:0061638  C:CENP-A containing chromatin  
GO:0000776  C:kinetochore  
GO:0005634  C:nucleus  
GO:0140483  F:kinetochore adaptor activity  
GO:0051301  P:cell division  
GO:0051321  P:meiotic cell cycle  
GO:1990813  P:meiotic centromeric cohesion protection  
GO:0045132  P:meiotic chromosome segregation  
GO:0051455  P:monopolar spindle attachment to meiosis I kinetochore  
KEGG spo:SPAC15E1.07c  -  
Amino Acid Sequences MAINNENELEYKLIKKNKNPKISNSKKKNSTRPALQDKTNQTLPIHQNQAFSNILPSDFSIIKTPETKTADDFPVNGYEGLNILKFDLELFYKLKPVATSTPKSCMRTGSNLFLNETVKHVPDERLVSNIKNTQTKDSITRDSAYYHRKTMTESIIKTLAAFDAEVDEIILF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.47
3 0.57
4 0.64
5 0.73
6 0.73
7 0.76
8 0.79
9 0.84
10 0.85
11 0.85
12 0.85
13 0.85
14 0.89
15 0.9
16 0.88
17 0.86
18 0.84
19 0.84
20 0.84
21 0.79
22 0.74
23 0.72
24 0.68
25 0.65
26 0.58
27 0.5
28 0.4
29 0.43
30 0.43
31 0.42
32 0.42
33 0.37
34 0.37
35 0.35
36 0.39
37 0.31
38 0.27
39 0.22
40 0.16
41 0.15
42 0.12
43 0.12
44 0.11
45 0.11
46 0.11
47 0.12
48 0.13
49 0.14
50 0.17
51 0.18
52 0.21
53 0.24
54 0.24
55 0.23
56 0.26
57 0.27
58 0.25
59 0.24
60 0.19
61 0.17
62 0.17
63 0.15
64 0.11
65 0.08
66 0.08
67 0.08
68 0.07
69 0.06
70 0.05
71 0.05
72 0.04
73 0.04
74 0.05
75 0.05
76 0.06
77 0.07
78 0.08
79 0.09
80 0.1
81 0.1
82 0.09
83 0.12
84 0.16
85 0.21
86 0.26
87 0.26
88 0.33
89 0.37
90 0.4
91 0.38
92 0.36
93 0.33
94 0.36
95 0.38
96 0.36
97 0.35
98 0.33
99 0.34
100 0.31
101 0.29
102 0.22
103 0.22
104 0.18
105 0.14
106 0.15
107 0.16
108 0.15
109 0.17
110 0.21
111 0.19
112 0.21
113 0.22
114 0.22
115 0.25
116 0.29
117 0.29
118 0.31
119 0.32
120 0.34
121 0.35
122 0.36
123 0.38
124 0.39
125 0.4
126 0.37
127 0.37
128 0.33
129 0.33
130 0.37
131 0.39
132 0.37
133 0.35
134 0.36
135 0.35
136 0.38
137 0.4
138 0.43
139 0.42
140 0.4
141 0.41
142 0.4
143 0.39
144 0.35
145 0.3
146 0.22
147 0.15
148 0.13
149 0.09
150 0.09
151 0.1
152 0.09