Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9P802

Protein Details
Accession Q9P802   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
167-194ISSLKKPKIEGKEGKKEKARTYSKRTRKBasic
NLS Segment(s)
PositionSequence
171-194KKPKIEGKEGKKEKARTYSKRTRK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034752  Mis18  
IPR004910  Yippee/Mis18/Cereblon  
Gene Ontology GO:0098654  C:CENP-A recruiting complex  
GO:0000785  C:chromatin  
GO:0000775  C:chromosome, centromeric region  
GO:0005737  C:cytoplasm  
GO:0000776  C:kinetochore  
GO:0005634  C:nucleus  
GO:0008270  F:zinc ion binding  
GO:0051301  P:cell division  
GO:0034080  P:CENP-A containing chromatin assembly  
GO:0007059  P:chromosome segregation  
GO:0000070  P:mitotic sister chromatid segregation  
KEGG spo:SPCC970.12  -  
Pfam View protein in Pfam  
PF03226  Yippee-Mis18  
PROSITE View protein in PROSITE  
PS51793  MIS18  
Amino Acid Sequences MSQTETSHSGYIDFKKESQPSVFQCKKCFQIVGDSNAWVISHREYLSFTLSDAVENSVRVEDTFKRSDDGLCVYSELSCTRCNEVIGKVYNSTPIYLDDIRDMYTFSMDKLQAYQLGNKTVNPEGLTRYQVDLEMREDIIKLKSFCLSLYEKFELHDETLRSVKETISSLKKPKIEGKEGKKEKARTYSKRTRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.34
3 0.37
4 0.39
5 0.39
6 0.41
7 0.41
8 0.5
9 0.56
10 0.52
11 0.55
12 0.56
13 0.56
14 0.52
15 0.49
16 0.39
17 0.41
18 0.43
19 0.44
20 0.4
21 0.36
22 0.32
23 0.3
24 0.29
25 0.19
26 0.16
27 0.11
28 0.13
29 0.13
30 0.14
31 0.15
32 0.17
33 0.19
34 0.17
35 0.15
36 0.14
37 0.14
38 0.13
39 0.12
40 0.13
41 0.11
42 0.11
43 0.11
44 0.09
45 0.09
46 0.09
47 0.11
48 0.12
49 0.18
50 0.2
51 0.2
52 0.21
53 0.21
54 0.22
55 0.2
56 0.2
57 0.16
58 0.14
59 0.14
60 0.12
61 0.12
62 0.12
63 0.11
64 0.09
65 0.1
66 0.11
67 0.13
68 0.14
69 0.15
70 0.16
71 0.16
72 0.19
73 0.2
74 0.19
75 0.18
76 0.17
77 0.2
78 0.18
79 0.17
80 0.13
81 0.11
82 0.14
83 0.13
84 0.13
85 0.11
86 0.11
87 0.11
88 0.11
89 0.1
90 0.07
91 0.08
92 0.08
93 0.07
94 0.1
95 0.09
96 0.09
97 0.1
98 0.11
99 0.13
100 0.14
101 0.18
102 0.17
103 0.21
104 0.22
105 0.21
106 0.23
107 0.21
108 0.21
109 0.18
110 0.17
111 0.16
112 0.18
113 0.19
114 0.17
115 0.17
116 0.16
117 0.16
118 0.16
119 0.14
120 0.14
121 0.14
122 0.13
123 0.12
124 0.12
125 0.12
126 0.14
127 0.16
128 0.15
129 0.15
130 0.16
131 0.16
132 0.16
133 0.19
134 0.21
135 0.2
136 0.26
137 0.28
138 0.26
139 0.27
140 0.28
141 0.26
142 0.23
143 0.25
144 0.19
145 0.2
146 0.23
147 0.23
148 0.23
149 0.21
150 0.2
151 0.18
152 0.2
153 0.24
154 0.29
155 0.35
156 0.41
157 0.47
158 0.49
159 0.51
160 0.57
161 0.59
162 0.61
163 0.64
164 0.67
165 0.72
166 0.76
167 0.8
168 0.8
169 0.78
170 0.76
171 0.77
172 0.77
173 0.76
174 0.79