FuNGI

A0A0D2B6N2

Protein Details

Accession

A0A0D2B6N2

Localization Confidence

Medium

Confidence Score

11.4

NoLS Segment(s)

Position	Sequence	Protein Nature
36-60	SVVLAKKLYRARKLRKLDTSRDTKS	Hydrophilic

NLS Segment(s)

Position	Sequence
143-174	QRRRRGSSGGSPQEKRENNTPKRGSRESKGKR

Subcellular Location(s)

nucl 10, cyto 9, extr 5, cyto_pero 5

Family & Domain DBs

InterPro	View protein in InterPro IPR036815 14-3-3_dom_sf

Amino Acid Sequences

MASSDVDQKYLGRIADASAPIAPLVSKALYQLLGLSVVLAKKLYRARKLRKLDTSRDTKSLQLYHQIIWLSREGLSILELSVMPYAGNGELGAECQVLVTKLRASFHHIFCLFHNNPPITTVSAYSSKRSTSQPLSPKHDNGQRRRRGSSGGSPQEKRENNTPKRGSRESKGKRQTLRDNIDSITSDASFLTNPYAGVQPGTTPPPGLTPSMPPGFAPLPPKPSAFLLPAIDFVPNTATYFRAASNIATLRLPGAHPLRLSVAIEHAAFLWDCVHDHSGSRSLARRAIRSLRDGEDIGITDEQYDDAADMVGVLGRMMKRKSWEGTPKPGAETSPPSAEPPSATKPVTGDPFPQTYPPPAPEPTLTSDLTPATPSKKMNVYRDVETVPSGFDGSPGGTPSSPAQERRGSRGSRHTRTGSKSTGQTVTPRDRKTTRDRASSFGDGMAPVRDARRSPDLPPAPPPKDPSPSMRSTSKQSTPRRDAPAQISPRDRIPTTPQRPSRPSTSGRTPSTPLKYPRPMEVSPKYPGGRLQEATAASGYHTDEGYGDSS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.17
2	0.23
3	0.23
4	0.21
5	0.18
6	0.18
7	0.16
8	0.16
9	0.14
10	0.08
11	0.1
12	0.1
13	0.09
14	0.1
15	0.13
16	0.13
17	0.13
18	0.13
19	0.11
20	0.11
21	0.11
22	0.1
23	0.1
24	0.1
25	0.11
26	0.11
27	0.1
28	0.16
29	0.24
30	0.31
31	0.39
32	0.49
33	0.59
34	0.69
35	0.79
36	0.82
37	0.85
38	0.86
39	0.86
40	0.85
41	0.84
42	0.79
43	0.74
44	0.66
45	0.59
46	0.57
47	0.52
48	0.45
49	0.44
50	0.42
51	0.38
52	0.39
53	0.37
54	0.31
55	0.29
56	0.28
57	0.21
58	0.18
59	0.18
60	0.14
61	0.13
62	0.13
63	0.1
64	0.08
65	0.08
66	0.08
67	0.08
68	0.08
69	0.08
70	0.07
71	0.06
72	0.07
73	0.06
74	0.06
75	0.05
76	0.06
77	0.06
78	0.07
79	0.08
80	0.06
81	0.06
82	0.06
83	0.07
84	0.07
85	0.08
86	0.09
87	0.12
88	0.14
89	0.17
90	0.18
91	0.26
92	0.33
93	0.34
94	0.41
95	0.38
96	0.37
97	0.37
98	0.46
99	0.38
100	0.35
101	0.4
102	0.32
103	0.31
104	0.32
105	0.32
106	0.24
107	0.23
108	0.2
109	0.17
110	0.23
111	0.24
112	0.26
113	0.26
114	0.25
115	0.27
116	0.29
117	0.33
118	0.32
119	0.39
120	0.45
121	0.51
122	0.58
123	0.6
124	0.6
125	0.61
126	0.63
127	0.63
128	0.65
129	0.68
130	0.69
131	0.69
132	0.69
133	0.64
134	0.61
135	0.58
136	0.57
137	0.57
138	0.57
139	0.58
140	0.57
141	0.58
142	0.62
143	0.59
144	0.53
145	0.53
146	0.54
147	0.54
148	0.62
149	0.66
150	0.63
151	0.68
152	0.72
153	0.67
154	0.64
155	0.68
156	0.66
157	0.7
158	0.73
159	0.73
160	0.72
161	0.75
162	0.77
163	0.76
164	0.74
165	0.67
166	0.6
167	0.52
168	0.48
169	0.4
170	0.31
171	0.22
172	0.15
173	0.12
174	0.1
175	0.1
176	0.08
177	0.07
178	0.08
179	0.07
180	0.07
181	0.08
182	0.09
183	0.08
184	0.09
185	0.08
186	0.08
187	0.1
188	0.12
189	0.11
190	0.1
191	0.1
192	0.12
193	0.14
194	0.14
195	0.13
196	0.13
197	0.18
198	0.19
199	0.19
200	0.16
201	0.18
202	0.18
203	0.19
204	0.22
205	0.19
206	0.23
207	0.24
208	0.25
209	0.22
210	0.23
211	0.23
212	0.2
213	0.2
214	0.16
215	0.15
216	0.16
217	0.15
218	0.14
219	0.11
220	0.1
221	0.09
222	0.07
223	0.08
224	0.07
225	0.07
226	0.08
227	0.09
228	0.09
229	0.09
230	0.09
231	0.09
232	0.12
233	0.12
234	0.12
235	0.11
236	0.11
237	0.1
238	0.1
239	0.1
240	0.11
241	0.12
242	0.13
243	0.13
244	0.14
245	0.14
246	0.14
247	0.15
248	0.1
249	0.09
250	0.09
251	0.09
252	0.08
253	0.07
254	0.07
255	0.06
256	0.06
257	0.06
258	0.04
259	0.05
260	0.06
261	0.07
262	0.07
263	0.07
264	0.09
265	0.12
266	0.12
267	0.14
268	0.16
269	0.16
270	0.21
271	0.23
272	0.23
273	0.23
274	0.3
275	0.3
276	0.3
277	0.32
278	0.29
279	0.29
280	0.28
281	0.24
282	0.18
283	0.16
284	0.14
285	0.11
286	0.09
287	0.07
288	0.06
289	0.06
290	0.05
291	0.05
292	0.03
293	0.03
294	0.03
295	0.03
296	0.03
297	0.03
298	0.03
299	0.03
300	0.03
301	0.04
302	0.05
303	0.09
304	0.1
305	0.11
306	0.14
307	0.18
308	0.21
309	0.27
310	0.37
311	0.39
312	0.48
313	0.51
314	0.49
315	0.47
316	0.46
317	0.38
318	0.31
319	0.3
320	0.24
321	0.21
322	0.21
323	0.2
324	0.2
325	0.2
326	0.18
327	0.18
328	0.2
329	0.21
330	0.21
331	0.2
332	0.21
333	0.24
334	0.26
335	0.23
336	0.21
337	0.21
338	0.23
339	0.23
340	0.24
341	0.21
342	0.22
343	0.23
344	0.23
345	0.23
346	0.22
347	0.23
348	0.23
349	0.24
350	0.25
351	0.26
352	0.24
353	0.21
354	0.21
355	0.19
356	0.18
357	0.17
358	0.14
359	0.13
360	0.16
361	0.17
362	0.19
363	0.26
364	0.32
365	0.37
366	0.44
367	0.44
368	0.44
369	0.46
370	0.43
371	0.37
372	0.31
373	0.25
374	0.17
375	0.14
376	0.12
377	0.09
378	0.08
379	0.08
380	0.08
381	0.08
382	0.09
383	0.1
384	0.09
385	0.1
386	0.11
387	0.17
388	0.2
389	0.21
390	0.25
391	0.31
392	0.34
393	0.4
394	0.46
395	0.42
396	0.44
397	0.53
398	0.58
399	0.57
400	0.62
401	0.61
402	0.6
403	0.64
404	0.65
405	0.59
406	0.54
407	0.51
408	0.49
409	0.46
410	0.4
411	0.39
412	0.4
413	0.46
414	0.49
415	0.48
416	0.5
417	0.51
418	0.56
419	0.61
420	0.64
421	0.62
422	0.64
423	0.64
424	0.62
425	0.65
426	0.61
427	0.52
428	0.41
429	0.34
430	0.24
431	0.23
432	0.19
433	0.14
434	0.12
435	0.13
436	0.14
437	0.14
438	0.19
439	0.26
440	0.28
441	0.29
442	0.39
443	0.42
444	0.43
445	0.51
446	0.55
447	0.51
448	0.52
449	0.56
450	0.52
451	0.53
452	0.53
453	0.52
454	0.5
455	0.51
456	0.53
457	0.53
458	0.5
459	0.51
460	0.56
461	0.56
462	0.59
463	0.63
464	0.69
465	0.71
466	0.76
467	0.77
468	0.73
469	0.71
470	0.69
471	0.69
472	0.65
473	0.64
474	0.6
475	0.54
476	0.55
477	0.54
478	0.48
479	0.42
480	0.45
481	0.49
482	0.53
483	0.61
484	0.64
485	0.68
486	0.73
487	0.74
488	0.72
489	0.69
490	0.66
491	0.64
492	0.66
493	0.66
494	0.66
495	0.65
496	0.61
497	0.63
498	0.64
499	0.64
500	0.6
501	0.61
502	0.65
503	0.63
504	0.67
505	0.65
506	0.61
507	0.63
508	0.63
509	0.59
510	0.54
511	0.59
512	0.52
513	0.47
514	0.49
515	0.46
516	0.45
517	0.41
518	0.39
519	0.37
520	0.36
521	0.36
522	0.32
523	0.24
524	0.18
525	0.19
526	0.17
527	0.14
528	0.13
529	0.11
530	0.11

A0A0D2B6N2

3D AlphaFold-predicted Structure Viewer