Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q8TFH1

Protein Details
Accession Q8TFH1    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
167-187RSEGRKFERARGRRKSRAFKVBasic
NLS Segment(s)
PositionSequence
143-187GKKHAREAYRHFGFGPHKHKAPYVRSEGRKFERARGRRKSRAFKV
Subcellular Location(s) nucl 13.5, mito_nucl 12.666, mito 10.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR021132  Ribosomal_L18/L18-A/B/e_CS  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:0005829  C:cytosol  
GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG spo:SPAPB17E12.13  -  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
PROSITE View protein in PROSITE  
PS01106  RIBOSOMAL_L18E  
Amino Acid Sequences MGIDIERHHVRKSQRSKPASENVYLKLLVKLYRFLARRTDSRFNKAILKRLFQSKTNRPPISISKIAALTSRKSASLEGKTTVIVGTVTDDERLLTVPKLSVAALRFTKSARARILKAGGEVLTLDQLALRAPTGSNTVLLRGKKHAREAYRHFGFGPHKHKAPYVRSEGRKFERARGRRKSRAFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.68
3 0.72
4 0.74
5 0.76
6 0.7
7 0.66
8 0.6
9 0.53
10 0.5
11 0.45
12 0.37
13 0.3
14 0.28
15 0.25
16 0.22
17 0.22
18 0.22
19 0.29
20 0.29
21 0.29
22 0.35
23 0.37
24 0.41
25 0.47
26 0.54
27 0.52
28 0.57
29 0.58
30 0.52
31 0.56
32 0.53
33 0.55
34 0.49
35 0.48
36 0.45
37 0.51
38 0.51
39 0.48
40 0.54
41 0.55
42 0.61
43 0.67
44 0.64
45 0.56
46 0.58
47 0.58
48 0.57
49 0.5
50 0.4
51 0.32
52 0.32
53 0.31
54 0.3
55 0.25
56 0.19
57 0.19
58 0.19
59 0.17
60 0.17
61 0.19
62 0.21
63 0.23
64 0.23
65 0.21
66 0.2
67 0.2
68 0.19
69 0.17
70 0.12
71 0.07
72 0.05
73 0.05
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.06
88 0.08
89 0.08
90 0.12
91 0.13
92 0.14
93 0.14
94 0.14
95 0.21
96 0.22
97 0.26
98 0.28
99 0.3
100 0.31
101 0.35
102 0.38
103 0.32
104 0.3
105 0.26
106 0.2
107 0.17
108 0.15
109 0.11
110 0.07
111 0.06
112 0.06
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.06
121 0.09
122 0.09
123 0.11
124 0.11
125 0.14
126 0.19
127 0.2
128 0.21
129 0.26
130 0.33
131 0.35
132 0.43
133 0.47
134 0.48
135 0.56
136 0.62
137 0.65
138 0.61
139 0.58
140 0.5
141 0.49
142 0.5
143 0.49
144 0.49
145 0.45
146 0.45
147 0.46
148 0.51
149 0.53
150 0.54
151 0.53
152 0.56
153 0.59
154 0.64
155 0.69
156 0.73
157 0.72
158 0.73
159 0.67
160 0.67
161 0.68
162 0.69
163 0.73
164 0.75
165 0.78
166 0.8
167 0.88