Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2A6W0

Protein Details
Accession A0A0D2A6W0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
62-89LPTNASPRMRRRWRWRRLRLKIEHFFRFHydrophilic
NLS Segment(s)
PositionSequence
69-81RMRRRWRWRRLRL
Subcellular Location(s) nucl 11, cyto 8.5, cyto_mito 7.5, mito 5.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASANLEYNKLYIVSQKEYIKLIGLTSGLIIEYHKKLDNYCKRREEKMMLLVKIESARSRYLPTNASPRMRRRWRWRRLRLKIEHFFRFGDFKKVVSWLERIAALVMLMYGWGWVCKLAWHGLWVGPQKLWAEARELV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.3
4 0.31
5 0.32
6 0.32
7 0.28
8 0.24
9 0.2
10 0.15
11 0.13
12 0.11
13 0.09
14 0.09
15 0.07
16 0.06
17 0.07
18 0.09
19 0.11
20 0.13
21 0.16
22 0.16
23 0.18
24 0.29
25 0.39
26 0.43
27 0.5
28 0.57
29 0.59
30 0.63
31 0.67
32 0.62
33 0.57
34 0.59
35 0.56
36 0.47
37 0.44
38 0.39
39 0.34
40 0.29
41 0.24
42 0.16
43 0.11
44 0.12
45 0.13
46 0.15
47 0.16
48 0.18
49 0.19
50 0.21
51 0.27
52 0.3
53 0.34
54 0.37
55 0.41
56 0.48
57 0.54
58 0.6
59 0.63
60 0.7
61 0.75
62 0.8
63 0.86
64 0.87
65 0.89
66 0.91
67 0.89
68 0.88
69 0.86
70 0.82
71 0.74
72 0.65
73 0.56
74 0.47
75 0.43
76 0.34
77 0.32
78 0.26
79 0.23
80 0.22
81 0.24
82 0.23
83 0.21
84 0.21
85 0.16
86 0.17
87 0.16
88 0.15
89 0.13
90 0.12
91 0.09
92 0.07
93 0.06
94 0.04
95 0.04
96 0.03
97 0.03
98 0.03
99 0.03
100 0.04
101 0.04
102 0.05
103 0.06
104 0.09
105 0.11
106 0.12
107 0.14
108 0.15
109 0.17
110 0.23
111 0.26
112 0.26
113 0.23
114 0.25
115 0.25
116 0.28
117 0.28
118 0.23