Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1YLC9

Protein Details
Accession A0A0D1YLC9    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-43DASSARIKKNKKTNQVKFKIRCHRNHydrophilic
NLS Segment(s)
PositionSequence
21-30SSARIKKNKK
73-84KKNVKGKRVAKA
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPKQVSDIKQFIEIARRKDASSARIKKNKKTNQVKFKIRCHRNLYTLVLKDSDRAEKLKQSLPPGLQIGETPKKNVKGKRVAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.39
3 0.38
4 0.35
5 0.4
6 0.42
7 0.4
8 0.46
9 0.5
10 0.53
11 0.61
12 0.65
13 0.68
14 0.75
15 0.77
16 0.76
17 0.78
18 0.79
19 0.81
20 0.86
21 0.88
22 0.84
23 0.85
24 0.85
25 0.79
26 0.77
27 0.73
28 0.68
29 0.61
30 0.57
31 0.52
32 0.47
33 0.43
34 0.36
35 0.3
36 0.26
37 0.24
38 0.22
39 0.21
40 0.17
41 0.18
42 0.19
43 0.22
44 0.26
45 0.29
46 0.31
47 0.32
48 0.36
49 0.35
50 0.36
51 0.33
52 0.3
53 0.26
54 0.23
55 0.27
56 0.29
57 0.29
58 0.3
59 0.35
60 0.42
61 0.49
62 0.55
63 0.57
64 0.6