Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2TRN1

Protein Details
Accession G2TRN1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
70-93KVHGMRKRKYYWKNDYMRGKNRNGBasic
NLS Segment(s)
Subcellular Location(s) mito 24, mito_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MGRSNHLFIFIHWKSRSIFSGNNKVYRFSNLYVRTNSWQKVRHLESLHTNAYIVPLEMRLIIMKTRQTFKVHGMRKRKYYWKNDYMRGKNRNGNLPTKKHQSKKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.37
4 0.31
5 0.37
6 0.36
7 0.46
8 0.48
9 0.53
10 0.5
11 0.49
12 0.46
13 0.44
14 0.41
15 0.32
16 0.36
17 0.35
18 0.38
19 0.39
20 0.4
21 0.4
22 0.42
23 0.42
24 0.39
25 0.39
26 0.37
27 0.43
28 0.44
29 0.45
30 0.41
31 0.4
32 0.41
33 0.4
34 0.38
35 0.3
36 0.26
37 0.2
38 0.19
39 0.16
40 0.1
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.04
47 0.05
48 0.06
49 0.08
50 0.11
51 0.14
52 0.17
53 0.21
54 0.24
55 0.25
56 0.32
57 0.39
58 0.43
59 0.49
60 0.56
61 0.59
62 0.63
63 0.69
64 0.72
65 0.72
66 0.75
67 0.77
68 0.77
69 0.78
70 0.8
71 0.83
72 0.83
73 0.83
74 0.8
75 0.78
76 0.74
77 0.72
78 0.73
79 0.67
80 0.68
81 0.67
82 0.68
83 0.69
84 0.73
85 0.76