A0A0D2B652

UniProt ID: A0A0D2B652   Organism: Verruconis gallopava
Gene: PV09_02418   Protein: Ribosomal protein L29
Length: 152 AA

Protein Details

• Accession: A0A0D2B652
• Localization Confidence: Medium
• Confidence Score: 10.6
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  102-123	AGLITEKQKKKQSQFPQRVYAV	Hydrophilic

• Subcellular Location(s): nucl 19.5, cyto_nucl 11.5, mito 4
• Family & Domain DBs:
  • InterPro:
    • IPR001854 Ribosomal_L29/L35
    • IPR036049 Ribosomal_L29/L35_sf
    • IPR045059 RL35
  • Gene Ontology:
    • GO:0022625 C:cytosolic large ribosomal subunit
    • GO:0003735 F:structural constituent of ribosome
    • GO:0000463 P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
    • GO:0006412 P:translation
  • Pfam:
    • PF00831 Ribosomal_L29
  • CDD:
    • cd00427 Ribosomal_L29_HIP
• Amino Acid Sequences: MSTGKVKAAQLWGKNKDELRKQLDELKQELVQLRTQKIAGGASSKLNKIHDVRKSIARTLTVITANQRQQLRLFYKNKKYVPLDLRPKQTRAMRRRLTKYEAGLITEKQKKKQSQFPQRVYAVKASA

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.57
2, 0.57
3, 0.57
4, 0.59
5, 0.6
6, 0.58
7, 0.56
8, 0.54
9, 0.58
10, 0.58
11, 0.55
12, 0.48
13, 0.43
14, 0.37
15, 0.35
16, 0.36
17, 0.29
18, 0.28
19, 0.28
20, 0.27
21, 0.24
22, 0.24
23, 0.22
24, 0.2
25, 0.19
26, 0.15
27, 0.13
28, 0.13
29, 0.16
30, 0.18
31, 0.18
32, 0.19
33, 0.19
34, 0.22
35, 0.24
36, 0.3
37, 0.31
38, 0.33
39, 0.34
40, 0.4
41, 0.41
42, 0.4
43, 0.38
44, 0.31
45, 0.27
46, 0.23
47, 0.23
48, 0.17
49, 0.15
50, 0.15
51, 0.18
52, 0.18
53, 0.22
54, 0.21
55, 0.2
56, 0.2
57, 0.26
58, 0.28
59, 0.32
60, 0.39
61, 0.43
62, 0.51
63, 0.59
64, 0.59
65, 0.6
66, 0.58
67, 0.58
68, 0.57
69, 0.59
70, 0.6
71, 0.58
72, 0.66
73, 0.63
74, 0.62
75, 0.6
76, 0.6
77, 0.61
78, 0.59
79, 0.63
80, 0.63
81, 0.68
82, 0.75
83, 0.75
84, 0.74
85, 0.69
86, 0.64
87, 0.61
88, 0.54
89, 0.48
90, 0.42
91, 0.37
92, 0.39
93, 0.43
94, 0.43
95, 0.43
96, 0.5
97, 0.56
98, 0.61
99, 0.69
100, 0.72
101, 0.74
102, 0.81
103, 0.82
104, 0.82
105, 0.78
106, 0.75
107, 0.68