Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9P6S6

Protein Details
Accession Q9P6S6   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
88-114AEFRWGYSARRRIRKQREEYFKNQDKSHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 13, cyto 6, nucl 5, pero 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0031965  C:nuclear membrane  
GO:0006886  P:intracellular protein transport  
GO:0015031  P:protein transport  
GO:0016192  P:vesicle-mediated transport  
KEGG spo:SPBC27.01c  -  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MGFDVAGYLQSYSLKDWIRIIVYVGGYMLIRPYLMKLGAKIQEREHRKSLLEGEVDGTLDPEMTHGTKPKEHGEFDTDDEEEEENPDAEFRWGYSARRRIRKQREEYFKNQDKSPLDAYADDDEDIEEHLED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.2
4 0.22
5 0.22
6 0.21
7 0.21
8 0.19
9 0.18
10 0.16
11 0.15
12 0.12
13 0.1
14 0.1
15 0.09
16 0.05
17 0.05
18 0.05
19 0.06
20 0.08
21 0.09
22 0.1
23 0.11
24 0.17
25 0.23
26 0.26
27 0.27
28 0.31
29 0.37
30 0.43
31 0.48
32 0.45
33 0.42
34 0.39
35 0.39
36 0.37
37 0.32
38 0.27
39 0.21
40 0.19
41 0.17
42 0.16
43 0.13
44 0.1
45 0.06
46 0.05
47 0.05
48 0.04
49 0.05
50 0.05
51 0.06
52 0.09
53 0.11
54 0.13
55 0.15
56 0.2
57 0.22
58 0.22
59 0.23
60 0.23
61 0.24
62 0.24
63 0.24
64 0.19
65 0.16
66 0.16
67 0.14
68 0.11
69 0.1
70 0.09
71 0.07
72 0.07
73 0.07
74 0.06
75 0.07
76 0.07
77 0.06
78 0.1
79 0.12
80 0.15
81 0.24
82 0.32
83 0.4
84 0.5
85 0.58
86 0.64
87 0.74
88 0.81
89 0.83
90 0.84
91 0.87
92 0.85
93 0.86
94 0.86
95 0.84
96 0.77
97 0.69
98 0.66
99 0.57
100 0.54
101 0.49
102 0.42
103 0.34
104 0.31
105 0.33
106 0.29
107 0.28
108 0.23
109 0.19
110 0.16
111 0.14
112 0.15